KEGG   Arachis ipaensis: 107630553Help
Entry
107630553         CDS       T04301                                 

Definition
(RefSeq) cation-chloride cotransporter 1 isoform X1
  KO
K14427  solute carrier family 12 (potassium/chloride transporter), member 4/5/6
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aip02000]
    107630553
Transporters [BR:aip02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   107630553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease SLC12 AA_permease_2 Na_Ala_symp
Motif
Other DBs
NCBI-GeneID: 107630553
NCBI-ProteinID: XP_016189213
LinkDB All DBs
Position
B03
AA seq 981 aa AA seqDB search
MEDVDLDGGGGSGRKYRPVLDSDRAVLEMSSMDPGSSSAASSSQPFRDQPPPNLRKINVG
NGATEASNAKEGNNSPSQPQPNGSHQESKLELFGFDSLVNILGLKSMTSEQAVQPSSPRE
GEDISITVGEPKPAAPKLGTMMGVFIPCIQSILGIIYYIRFSWIVGMAGIGESFLLVALC
GLCTFLTSISLSAIATNGAMKGGGPYYLIGRALGPEVGVSIGICFFLGNAVAGALYVLGA
VETFLKAVPKAGIFRETVSHVNGTAVTPIEAPSSHDLQIYGIVVTILLCFIVFGGVKMIN
RVAPAFLVPVLFSVICIFLGMFVAKKDKPSEGFTGLSWETIKDNWSSDYQKTNDAGIPET
DGHVSWNFNSLVGLFFPAVTGIMAGSNRSASLKDTQQSIPIGTLSATLITTSLYFISVLF
FGAVATREKLLTDRLLTATVAWPFPSLIKIGIILSTLGAALQSLTGAPRLLAAIANDDIL
PILRYFKVADGSEPYAATLFTAILCGVCVIIGNLDLITPTITMFFLLCYTGVNLSCFLLD
LLDAPSWRPRWKFHHWFLSLVGALLCIVIMFLISWPFTVVALALASLIYKYVGLKGKAGD
WGDGFKSAYFQLALRSLRSLGENQVHPKNWYPIPLVFCRPWGQLPENVPCHPKLADFANC
MKKKGRGMSIFVSILDGDYHECAEDAKTACKQLSTYINYKNCEGVAEIVVAPNMSEGFRG
IVQTMGLGNLKPNIVVMRYPEIWRRENLTEIPKTFVGIINDCIVANKAVVIVKGLDEWPN
EYQKQYGTIDLYWIVRDGGLMLLLSQLLLTKDSFESCKIQVFCIAEEDADAEVLKADVRK
FLYDLRMQAEVFVIPISSQENGGSPQDESQDAFKGAQQRIDDYLNKMKAAAKKDGTPLMA
DGKRAVVNEQQVEKFLFTTLKLNSIMLRYSRMAAVVLVSLPPPPLNHPAYFYMEYMDMLL
ENIPRILIVRGYRRDVVTLFT
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgtggaccttgacggtggcggtggcagtggtcgcaagtatcggcctgtgttg
gacagcgatcgtgcggtgcttgagatgtcttcaatggatcctggatcctcttccgctgct
tcttcttctcaaccgtttcgggatcaacctcctcctaatctcagaaaaataaacgtgggt
aatggtgctactgaggcttctaatgctaaagaagggaacaactctcctagtcagccacag
cctaatggatcccatcaagaatcaaagcttgaactgtttggttttgattcccttgtcaat
atacttggtcttaaaagcatgactagtgagcaagctgtgcaaccatctagtcctagagaa
ggcgaagatatttctatcactgtaggggagccaaagcctgctgctcccaagctgggtaca
atgatgggtgtattcattccatgcatacaaagcattttgggcatcatctactacattcgt
ttctcttggattgttggaatggctggcataggagagtcatttctgcttgttgctttgtgt
ggcttgtgtacttttcttacatcaatatcattgagtgccattgcgactaatggtgctatg
aagggaggggggccatactatctaataggtcgtgcccttggtccagaagttggagttagc
attggtatatgtttcttccttgggaatgctgttgctggagcactctacgtattgggagct
gtggaaacatttttgaaagcagttcctaaagctgggatttttagagagactgtcagccat
gttaatggtactgcagtgacaccaatagaagctccaagttctcatgatctgcaaatttat
gggattgttgtgaccattcttttatgctttattgtatttggaggagtaaagatgataaat
cgggttgcacctgcatttctcgttcctgttttattctcagtcatctgcatattcttggga
atgtttgtggctaagaaggataaaccttcagagggatttactggtttgagttgggagaca
attaaagataattggagttcagattatcaaaaaactaatgatgctggaatcccagaaact
gatggccatgtaagctggaatttcaattcattagtaggcctctttttcccagctgtgaca
ggaataatggcaggttctaatagatcagcttctctaaaagatactcagcaatcaattcct
attgggacattatctgcaacacttattactacttctctgtattttatttctgtgttattt
tttggcgctgttgccaccagagagaagcttttaacagacaggctactaacggctacagtc
gcctggccttttccttcactaattaaaattgggattattctttcaactttgggtgctgct
cttcagagtctgaccggtgccccacgtctgcttgcagcaatagccaatgatgatatttta
cctattctgcgctactttaaagttgcagatggcagtgagccttatgctgctacccttttc
actgctatcctatgtggtgtgtgtgtcattattgggaatctggatcttatcactccaact
ataactatgtttttccttctatgttatacgggtgtcaacttgtcctgcttccttcttgat
cttctagatgctcctagttggcgacctcgttggaaatttcatcattggtttctctctctt
gttggagcattactttgcattgtgattatgttcctgatctcgtggccattcactgtggtg
gctttggcccttgcaagtcttatatataagtatgtgggcctcaaaggaaaggctggcgac
tggggagatggtttcaaaagtgcatatttccaactagcacttcggagccttcgatcacta
ggagaaaaccaagtacacccaaagaattggtatccaattccactcgtgttttgccggccc
tggggtcaactaccagaaaatgttccatgtcatcccaaacttgcagattttgctaactgt
atgaagaagaaaggtcgaggaatgtctatatttgtctctatactggatggagactaccat
gaatgtgctgaagatgccaagactgcttgtaaacagctcagtacctacattaattacaag
aattgtgaaggtgtggctgagattgttgtcgcccctaatatgtctgaaggctttcgtggt
atcgttcagacaatgggccttgggaatctcaagccaaacattgtggtgatgcgctaccca
gagatctggcgtcgggagaacttaacagaaatccccaagacatttgttgggataattaac
gactgcattgttgcaaacaaggcagtagtcatagtgaagggtcttgatgagtggcccaat
gagtaccagaagcagtacggcacgattgacctctactggattgtgagagacggtggtctc
atgctgctgctctctcagctgcttcttaccaaggacagctttgagagttgcaaaattcag
gttttctgcattgcagaagaggatgcagatgcagaagtgctgaaagctgatgtgagaaaa
ttcctttatgatcttcggatgcaagcagaagtctttgtcattcccatttcttcacaagaa
aatggtgggtctccccaggatgagtcacaggatgcatttaaaggtgctcaacaaagaatt
gatgattatctaaacaaaatgaaggcagcagcaaagaaagatggcacccctctaatggca
gatggtaagcgcgcagttgtgaatgagcagcaggtcgagaagttcctgttcacaacgctt
aagctcaattcaataatgttgagatactcaagaatggctgctgttgttttggtaagtttg
cctccacctccactgaaccacccagcatatttctatatggagtacatggatatgttgctg
gaaaatataccgaggattttaattgtaagaggataccgtagagacgttgtaactctattc
acatag

DBGET integrated database retrieval system