KEGG   Arachis ipaensis: 107631463Help
Entry
107631463         CDS       T04301                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial isoform X1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00053  Ascorbate and aldarate metabolism
aip00071  Fatty acid degradation
aip00280  Valine, leucine and isoleucine degradation
aip00310  Lysine degradation
aip00330  Arginine and proline metabolism
aip00340  Histidine metabolism
aip00380  Tryptophan metabolism
aip00410  beta-Alanine metabolism
aip00561  Glycerolipid metabolism
aip00620  Pyruvate metabolism
aip00903  Limonene and pinene degradation
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107631463
   00053 Ascorbate and aldarate metabolism
    107631463
   00620 Pyruvate metabolism
    107631463
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107631463
   00561 Glycerolipid metabolism
    107631463
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107631463
   00310 Lysine degradation
    107631463
   00330 Arginine and proline metabolism
    107631463
   00340 Histidine metabolism
    107631463
   00380 Tryptophan metabolism
    107631463
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107631463
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107631463
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107631463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107631463
NCBI-ProteinID: XP_016190409
LinkDB All DBs
Position
B03
AA seq 535 aa AA seqDB search
MASSSTRISRLLSRSSASLFSRGGKGYLGTGFSRYSTATALEEEPIKPAVQVEHTQLLIG
GKFVDALSGKTFPTLDPRTGEVIAHVAEGHSEDVDRAVAAARKAFDQGPWPKMTAYERQR
ILLRAADLLEKHNDELAALETWDNGKPYEQSAQIEIPMLVRLFRYYAGWADKIHGMTVPA
DGQYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLSALYAAK
LFHEAGLPEGVLNVVSGFGPTAGAALASHMDVDKLAFTGSTDTGKVVLELAARSNLKPVT
LELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTYVHEHVYDEFVEKAKARA
LKRIVGDPFKSGIEQGPQIDSEQFEKILKYIRSGVQSGATLETGGDRLGSKGFYVQPTVF
SNVEDGMLIAKEEIFGPVQSILKFKDLDEVIERANNTRYGLAAGVFTKNIDTANTLTRAL
RVGTVWVNCFDTFDAAIPFGGYKMSGQGREKGEYSLKNYLQVKAVVTPLKNPAWL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcttcaaccaggatctccaggcttctctctcgctcctccgcctctctcttt
tcgcgaggtgggaagggttaccttggtacaggattcagcagatatagcactgccactgcc
cttgaagaagaaccaattaaaccagcagtgcaagtagaacacacccaactcctgattggt
gggaaattcgttgatgctctttctggtaaaacttttccaaccttggatccaagaacaggg
gaagtgattgctcatgttgctgagggtcactctgaagatgttgatagagcagttgcagcc
gcaagaaaggcatttgatcaaggtccatggcctaagatgacagcctatgaaaggcaaagg
atattgttgcgagccgccgatctgcttgagaagcacaatgatgagcttgcagcacttgag
acctgggataatgggaagccatatgaacaatctgctcagattgaaatcccaatgcttgtt
cgccttttccggtactatgccggttgggcagataagatccatggtatgacagttccggct
gatgggcaatatcatgtgcaaacattgcacgaaccgatcggtgttgctggtcagatcatt
ccctggaatttccctctcctcatgtttgcttggaaggttggaccggcattggcctgtggc
aatacaattgttctgaaaaccgctgagcagacaccattgtctgctttgtacgcagcaaaa
ctatttcatgaggctggacttcctgaaggtgttttgaatgtggtatcaggctttggtccc
actgccggcgctgctcttgcaagtcacatggatgtggataagcttgcctttactggttct
actgataccgggaaagttgtccttgagctagcggctagaagcaatcttaagccagtaact
ttggagcttggtggaaaatctccttttattgtatgtgaggatgccgatgtagatcaggcg
gttgagctagcacactttgccttattctttaatcagggacaatgttgctgtgctgggtct
aggacatatgtacatgagcatgtatatgacgagtttgtagagaaagcaaaggctcgtgct
ttgaaacgtattgttggtgatccattcaagagtggaatagagcaaggtccgcagattgat
tctgaacaatttgagaagatactgaagtatatcagatccggcgttcaaagtggagctaca
ctagaaaccggaggagatagacttggcagcaagggcttctatgttcagcctaccgtcttc
tcaaatgttgaggatggcatgctgattgcaaaggaagaaatatttggcccggtgcaatcc
atactaaaattcaaggacctcgatgaggttattgaaagagcgaacaacacgcggtatgga
ctggcggcaggggtgttcacgaagaacatagacacggcaaacacgctgacgagagcgttg
agagttggaacagtttgggtgaactgctttgacacatttgatgcagcaattccatttggt
ggttacaagatgagtgggcagggaagggaaaagggagagtacagcctcaagaattacttg
caagtcaaggcagttgttacccctttgaagaaccctgcatggctttag

DBGET integrated database retrieval system