KEGG   Arachis ipaensis: 107632337Help
Entry
107632337         CDS       T04301                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aip  Arachis ipaensis
Pathway
aip00010  Glycolysis / Gluconeogenesis
aip00053  Ascorbate and aldarate metabolism
aip00071  Fatty acid degradation
aip00280  Valine, leucine and isoleucine degradation
aip00310  Lysine degradation
aip00330  Arginine and proline metabolism
aip00340  Histidine metabolism
aip00380  Tryptophan metabolism
aip00410  beta-Alanine metabolism
aip00561  Glycerolipid metabolism
aip00620  Pyruvate metabolism
aip00903  Limonene and pinene degradation
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107632337
   00053 Ascorbate and aldarate metabolism
    107632337
   00620 Pyruvate metabolism
    107632337
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107632337
   00561 Glycerolipid metabolism
    107632337
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107632337
   00310 Lysine degradation
    107632337
   00330 Arginine and proline metabolism
    107632337
   00340 Histidine metabolism
    107632337
   00380 Tryptophan metabolism
    107632337
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107632337
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107632337
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107632337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 107632337
NCBI-ProteinID: XP_016191519
LinkDB All DBs
Position
B01
AA seq 540 aa AA seqDB search
MAARRLSWLLSRSLSAASGADSFLHSLGRNSGGGCRKLKRFSTAAAVDEVIIPQVQINYT
QHLIDGKFVDSASGKTFPTYDPRTGEVIAQVAEGDAEDINRAVAAARKAFDEGPWPKMTA
YERCRILLRFADLVEKHSKELAALETWNNGKPYEQSFNDELPLFVRLFHYYAGWADKIHG
MTVPADGKYHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTVILKTAEQTPLTA
LYVAKLFHEAGLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTDTGKIVLELAARSN
LKPVTLELGGKSPFIVCHDADVDHAVEQAHFALFFNQGQCCCAGSRTFVHERIYDEFLEK
SKKRALRRVVGDPFKKGVEQGPQIDTEQFEKVLRYIRSGIESNATLECGGQRLGSKGFFI
EPTVFSNVKDDMLIAKDEIFGPVQSILKFKDIEEVIKRANATRYGLAAGVFTKNVHTANT
LMRALRVGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQIKAVVEPLKNPAWI
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgcagactttcatggcttctctcacgctccctttctgctgcttctggagct
gactcttttcttcactcactcggaagaaactctggcggagggtgcagaaaactgaagagg
tttagcacagctgcagcggttgatgaagtgattattccacaagttcaaatcaattacact
cagcatctcatagatggcaagtttgtggattctgcatcagggaagacttttccaacctat
gacccgcgcacaggggaagttatagctcaagtagctgaaggagacgccgaagatatcaac
cgcgccgtcgcagcagcacgaaaggcctttgatgaaggaccctggcctaaaatgactgct
tatgaaaggtgtcggatattgctgcggtttgctgatttggtggagaagcatagtaaagag
cttgcagctctagagacatggaacaatggaaagccttatgagcaatctttcaacgacgaa
ttgccattgtttgtgcgtttgttccactactatgctggttgggctgataaaattcacggg
atgactgtaccggctgatggaaaatatcacgtgcaaacattgcatgaaccaattggggtt
gcaggacaaatcataccttggaattttcctctaattatgtttgcttggaaagttggtcca
gctctggcttgtggtaacactgtcattttgaagactgctgagcaaacacccctcaccgct
ctttatgtggctaaactctttcatgaggctggtcttccaccaggtgttctgaatatagtt
tctggatttggcccaactgctggtgcagctcttgcaagtcacatggacgttgacaagcta
gcatttactggatcaacagacactggaaaaattgtgcttgaattggctgcaagaagcaat
ctgaagcctgtgacattggagttaggaggcaaatcaccttttattgtgtgtcatgatgct
gatgttgaccacgctgttgaacaagcacactttgctctcttctttaatcagggacaatgt
tgctgtgctgggtctcgaacctttgtacatgagcgtatctatgatgagttcttggagaag
tcaaagaaacgtgctttgagacgcgttgttggtgatccattcaagaagggtgttgaacaa
ggccctcagattgacacagaacaatttgagaaagtgcttaggtacataagatctggaatt
gaaagcaatgctacccttgaatgtgggggtcagcgattgggctcaaaaggcttcttcatc
gagccaactgttttctccaatgttaaggacgatatgctgatagccaaagacgaaatattc
gggccggttcagtccatcttgaaattcaaggacattgaagaagtaataaagagagcaaat
gcaacacgatatggactagcagcaggagtgttcacaaagaacgtacacacagcaaacaca
ttgatgagggcactgagagttggaacggtttggatcaactgtttcgatgtattcgacgct
gccattccctttggaggctacaagatgagtggcattgggagggagaaaggaatctacagt
ctcaacaactaccttcagatcaaagctgttgttgaaccactcaagaatcctgcttggatt
taa

DBGET integrated database retrieval system