KEGG   Arachis ipaensis: 107635689Help
Entry
107635689         CDS       T04301                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aip  Arachis ipaensis
Pathway
aip03030  DNA replication
aip03410  Base excision repair
aip03420  Nucleotide excision repair
aip03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aip00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107635689
   03410 Base excision repair
    107635689
   03420 Nucleotide excision repair
    107635689
   03430 Mismatch repair
    107635689
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aip03032]
    107635689
   03400 DNA repair and recombination proteins [BR:aip03400]
    107635689
Enzymes [BR:aip01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107635689
    6.5.1.6  DNA ligase (ATP or NAD+)
     107635689
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107635689
DNA replication proteins [BR:aip03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107635689
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107635689
DNA repair and recombination proteins [BR:aip03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107635689
   NER (nucleotide excision repair)
    Other NER factors
     107635689
   MMR (mismatch excision repair)
    Other MMR factors
     107635689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 107635689
NCBI-ProteinID: XP_020977926
LinkDB All DBs
Position
B04
AA seq 1410 aa AA seqDB search
MDPQLTPQTLNSTSLFLAATTATTHSEQPPHSLSLTTVPSTVPRSKLIPNTRFLVDAFRH
ADTAFSVSYFLSHFHSDHYTGLSHSWSRGIVFCSATTASLLQRILGVPKRFLVPLPLCQP
VEIDGAEVTLVDANHCPGAVQFLFKVPTKEEGKKFERYVHTGDFRFCNSMILEPAILDFV
GCDAVFLDTTYCNPKFVFPSQEESVDYVVSVVERVISDCGGDGSGVLFLVATYVIGKEKI
LVELARRVKRKVHVDARKMEVLRVLGYGESGVFTEDSSESNIHVVGWNVLGETWPYFKPN
FVRMKEIMIERGYSKVVGFVPTGWTYEVKGNTFAVRSKDSFEIHLVPYSEHSNYEELREY
VKFLKPRGVVPTVGLDVEKSDSKHAEKMRKYFAGLVDETANKHEFLKGFHRATGDTDFLV
EKDVNDGQKPGKNMEEGIKPSELDGEESTTPYVAASVPSSTGEPCTESVTLLTDEEKEKM
IEELGNCLPAWVTRSQMLELISISGSNVVEAASNFYERETEFHKQAFSCQTSSVSKCSSL
NDIDSPSKACLNSSSTTKNNDVFPSQDSTKLTILKHTVLSQASSAKRNKISGSKPNKKVK
VKAKSQSQSSDPKQSTITKFFSKVLPVKPSVAQSDRSELMIGVSPKAKNMLPDDVGNQYK
DEIDQFMQIINGKESLKDHAITIIEKAKGDVNKALDIYYCNSGNLGEKEISVQAECKIDS
SLEKNCVLHELKGIPDTTMKRNHVTLPLEKYNPKEHACWKDGQPAPYLHLARTFSLLEDE
KGKIKATSMLCNTFRSLLALSPADVLPAVYLCTNKIAADHEKMELNIGGSIVTAALEEAC
GTNRSKIREMYNKFGDLGWMISVRILNNDEYPGIIKGDVAQECRQTQRLLAPPTPLLIKD
VFSALQKISLQTGHGSTSRKKDIIIRLMCSCREKEIKFLVRTLVRNLRIGAMLRTVLPPX
AQAVVMNFFGVCITEIFSXSLQVLSVEIVEAYNIIPNLDLIVPSLMNKGIDFSVSSLSMV
PGIPIKPMLATITNGIPKALNLFQNKAFTCEYKYDGQRAQIHRLIDGSIRVFSRNGDEST
SRFPDLIDIIKESCKPVASTFIIDAEVVGIDRKNGFRIMSFQELSSRGKGSKDTLVTTES
IKVDICIFVFDIMFANGEQLLGFPLRTRRKYLKDLLCDEKPGYFEYAKEITIEADKACET
CKDTLTKINAFLEDALRSSCEGIMVKTLDVDAGYSPSKRSDKWLKVKRDYVDGLNDTLDL
VPIGAWHGNGRKAGWYSPFLMACYNPETEEYQSVCRVMSGFSDSFYIEMKEFFSGDKVLS
KKPLYYRTAEKPDMWFCPQLVWEIRGAEFTVSPVHHAAIGLIHLSRGISIRFPRFIRRVS
DRNPEECSTAADIVNLFHSQPRKKDVTAED
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atggatccacaactcacaccccaaaccctaaactccaccagtttattccttgccgccaca
acagccaccactcattccgaacaaccaccacattcactctccctcaccaccgttccttcc
accgtaccacgctccaagctcatcccgaacactcgcttcctcgtcgacgccttccgccac
gccgacacagcattctccgtctcctacttcctctctcacttccactccgatcactacacc
ggtctctcccattcttggtcccgcggcattgtcttctgctccgccaccaccgcctccctc
ctccaacgaatcctcggagtccccaaacgcttccttgtaccccttcccctttgccagccc
gttgaaatcgacggcgcggaggtcacgctggtcgacgcgaaccactgccctggcgcggtc
cagttcctattcaaggtcccaacaaaagaagaagggaagaaattcgagaggtatgttcac
actggcgatttcaggttttgtaattcaatgattttggagcctgcaattcttgatttcgtt
ggctgtgatgctgtgttcttggatactacttattgcaacccaaagtttgtgtttccttcg
caagaggagagtgttgattatgtggttagtgtagtcgagagggttattagtgattgtggt
ggtgatggtagtggtgttttgtttcttgttgctacttatgttattgggaaggaaaagatt
ttggttgaacttgcacggagagtgaagaggaaggtgcatgtggatgctaggaaaatggag
gttttgagggtgcttgggtatggagagagtggtgtgtttaccgaggacagttcagagagt
aatattcatgttgttggctggaatgtattgggggagacatggccgtattttaagccaaat
ttcgttaggatgaaggagattatgattgagagagggtactccaaggttgtgggatttgtg
ccaaccggatggacttatgaagtaaagggcaatacgttcgcagtgaggtccaaggattca
tttgagattcatctcgtgccgtatagcgagcattccaactacgaggagctcagggagtat
gtgaagtttttgaagccaaggggtgttgttccgacagtgggtttggatgttgagaaaagc
gacagtaagcatgctgaaaaaatgaggaagtattttgctggattggttgatgagacggcc
aacaagcatgaatttctaaagggatttcaccgtgccacaggcgacacagatttcttggtt
gagaaggatgttaatgatggtcagaagccaggaaaaaacatggaggaaggaatcaagcca
tctgagttggatggtgaggaaagtacaactccgtatgttgctgctagtgtgccctcttct
actggggaaccgtgtacagaaagtgttactttactaactgatgaagaaaaagagaaaatg
attgaagaacttggtaattgtttgccggcatgggtcactcgaagccaaatgttagagctg
atcagcatctcagggagcaatgttgttgaagctgcttctaatttttatgaacgtgaaact
gaatttcacaagcaagcattttcttgtcaaacttcttcggtgtccaagtgcagctcacta
aatgacatagattctccttcaaaagcttgcctgaattcgagcagcactaccaaaaataac
gatgtttttccaagccaggactctactaaactaactatcttgaagcatacagttttaagt
caagcttcctctgccaaaaggaataaaattagtggaagtaagccaaacaagaaagtaaaa
gtcaaagcaaagtcacagtcacaatcaagtgatccaaagcagtccaccataacaaaattc
ttcagcaaagtattgcctgtgaagcctagtgttgctcagtctgatcgttctgaattgatg
attggcgtaagccctaaagccaaaaatatgttgccagatgatgttggaaatcagtacaag
gatgagattgatcagtttatgcaaataataaatgggaaagagtcattaaaagatcatgcc
ataactataattgagaaggcaaaaggagatgtaaataaggcattggatatatattactgt
aattctggaaatcttggtgaaaaggaaatttcagttcaagcagagtgtaaaattgatagc
tctttagagaagaattgtgtgttacatgaattgaaaggtattcctgacaccactatgaag
agaaatcatgtaactctaccacttgagaaatacaatcctaaagagcatgcttgttggaaa
gatgggcagcctgcaccatatttacatcttgcacgaaccttcagccttctggaggatgag
aaaggaaagattaaggctacttcaatgttatgcaatacattccgaagtttgctggccctg
tctccagcagatgtgctgcctgctgtgtacctatgtacaaacaaaattgcagcagaccat
gaaaagatggaactaaacattggtggaagtatagttactgcagcacttgaagaggcatgc
ggaacaaatcgatccaaaataagggagatgtataacaaatttggcgatcttggttggatg
atttctgtgaggattttgaataatgatgaatatcctgggattattaaaggtgatgttgct
caagagtgtcgtcaaacacagagattgcttgcaccaccaacaccacttctgattaaggat
gttttctctgcactgcaaaagataagtttacaaacaggccatggaagcacatctcggaag
aaagacattatcattcgtctcatgtgttcctgtcgtgagaaggagattaaatttcttgtt
cggaccttggtcaggaacttaaggattggggcaatgcttagaactgttttacctccataa
gctcaagctgttgttatgaatttctttggggtttgtattactgaaattttctcttaatcg
ctacaggtcctttctgtggaaattgttgaagcatataacataattccgaatttggatctc
atagttccatctctcatgaacaaaggaattgatttttcggtttcaagtttgtcaatggtt
cctggaattcctattaagcctatgcttgcaacgatcaccaatggcattcccaaggcattg
aacctatttcaaaataaggcatttacttgtgaatataagtatgatggtcagcgagctcaa
attcacagattaattgatggatcaattcgtgttttttcaagaaatggagatgaatcaaca
tcaagatttcctgatcttattgacataattaaggaatcctgcaagcctgttgcttcgact
ttcataattgatgctgaagttgttggtattgatagaaaaaatggatttaggattatgtct
ttccaggagctatcttcacgtggtaaaggaagcaaagatactctagttactacagagagc
ataaaggtggatatttgcatatttgtctttgatatcatgtttgcaaatggagagcagcta
ttgggttttcctcttcgcacaagacggaaatatctaaaggatttgttatgtgatgaaaaa
ccagggtattttgaatatgcaaaggaaataacaattgaagcagacaaggcttgcgaaact
tgtaaagacacattaaccaagataaacgctttcttggaagatgctcttcgttcttcctgt
gaaggaattatggtgaaaacattggatgtagatgctggttattctccgtcaaagcgttct
gataaatggttaaaggtcaaacgagattatgtcgatggtttaaatgatactcttgatttg
gtgccaattggagcttggcatggaaatggaaggaaggccggatggtatagtccatttctc
atggcatgttataatcctgaaactgaggaatatcaaagcgtgtgccgagtgatgtctggg
ttctcagattcgttttacatagagatgaaagaattcttctctggggacaaagtcttatcc
aaaaagccgctgtattatcgaacagcagagaagcccgacatgtggttttgtccgcaactt
gtttgggagatacgaggtgcagagttcacggtgtcccctgttcatcatgcagccatcggt
ttaattcatctgtctcggggcatctcaatacggtttccgagatttattaggcgtgtgtcg
gataggaacccagaagagtgtagtacagcagcagatattgttaatttgtttcattctcag
ccaaggaagaaggatgtcacagctgaagattga

DBGET integrated database retrieval system