KEGG   Arachis ipaensis: 107638260Help
Entry
107638260         CDS       T04301                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase MIEL1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
aip  Arachis ipaensis
Pathway
aip04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107638260
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aip04121]
    107638260
Enzymes [BR:aip01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     107638260
Ubiquitin system [BR:aip04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    107638260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_2 zf-C3HC4 zf-RING_4
Motif
Other DBs
NCBI-GeneID: 107638260
NCBI-ProteinID: XP_016196934
LinkDB All DBs
Position
B01
AA seq 268 aa AA seqDB search
MEGSANNERLDFGRMGYGCKHYRRRCKIRAPCCNEIYPCRHCHNEAASLLRNPYDRHELV
RQDVKQVVCAVCDTEQPVAQVCTNCGVRMGEYFCDICKFFDDDIGKQQFHCDDCGICRVG
GQENFFHCEKCGSCYSVTLRDNHLCVENSMRHHCPICYEFLFDSMKDISVMKCGHTMHHE
CFEEMLNRDTYCCPICSKSVMDMTRTWKRIDEEIEATVMPEDYRHRKVWILCNDCNDTTE
VFFHILGQKCGHCQSYNTRAIAPPVLPQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaggctctgcaaacaatgaacgtcttgattttgggaggatgggctatgggtgcaag
cattataggaggagatgcaagattcgtgcaccttgctgcaatgagatctacccctgccgc
cattgccataacgaggctgcgagcttgttgaggaacccctatgatcgccacgaacttgtt
cgccaagatgttaaacaagttgtttgtgcagtttgtgacactgagcagccggtcgctcaa
gtttgcacaaactgtggagttagaatgggagagtatttctgtgacatctgcaaattcttc
gatgatgatatagggaaacaacagtttcattgtgatgattgtggaatctgtagggttggt
ggtcaagagaattttttccactgcgagaagtgtgggtcatgctattcagttacactgcgt
gacaatcatttgtgtgtggagaactccatgaggcaccactgccccatttgttacgagttc
ctttttgattcaatgaaagacatcagtgtcatgaaatgtggtcacaccatgcaccatgaa
tgctttgaagagatgctaaatcgcgacacgtactgctgtcccatatgctccaagtcagtg
atggacatgaccaggacatggaagagaattgatgaagagattgaagcaactgtcatgccc
gaagattatcggcataggaaggtttggatattatgcaatgactgcaatgacacaacagaa
gtgttcttccacattctggggcaaaaatgtggtcactgccaatcgtataatacgcgtgca
atcgctcctccggttcttcctcaatga

DBGET integrated database retrieval system