KEGG   Arachis ipaensis: 107638958Help
Entry
107638958         CDS       T04301                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aip  Arachis ipaensis
Pathway
aip00052  Galactose metabolism
aip00500  Starch and sucrose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107638958
   00500 Starch and sucrose metabolism
    107638958
Enzymes [BR:aip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107638958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107638958
NCBI-ProteinID: XP_016197842
LinkDB All DBs
Position
B04
AA seq 864 aa AA seqDB search
MSSRHERRDTMLPLLLFLCIIFRHGVEASTLTEEVVGYGYTISTVASDHFGKSLTATLSL
IKSSSLHGPDIPQLKLSASFENKDRLRVRITDSTHQRWEIPEEVIPRGSYYPHCSLSTKQ
FPSKQEVKLSLTIANSDLIFSLHNTTPFGFTISRKSSKDILFDLYGLGEHTKRSFKLQPH
QTLTMWNSDTFSAILDLNLYGSHPFYMDVRKGSKDGRVKSGSTHGVLLLNSNGMDVAYGG
DRITYKVIGGVFDLYFFSGSSPELVMEQYTELIGRPAPMPYWSFGFHQCRWGYKNVSDLK
GVVANYAKANIPLEVMWTDIDYMDAYQDFTLDPINFPLDKMKTFVDTLHKNGQKYVLILD
PGIHVNQTYATFVRGLQDDIYIKRNGVNYLGQVWPGPVYYPDFLNPSSQKFWGTEIKLFR
ELLPFDGIWLDMNELSNFITSPPNPSSSLDNPPYKINNSGVMQQINYRTVPATSLHFGNI
TEYDSHNLYGLLESKATNKVLKDISGKRPFILSRSTFVSSGKYTAHWTGDNAATWNNLAY
SIPSILNFGIFGIPMVGADICGFSGNTTEELCRRWIQLGAFYPFARDHSDNTSNRQELYL
WDSVAESARKVLGLRYRLLPYLYTLMYEAHTKGTPIARPLFFSFPEDVTTYDISSQFLLG
KGVLVSPVLKPGAITVDAYFPVGNWFDLFNFSNSVSAESGKYVTLDAPSDHINVHVGEGN
ILAMQGEALTTEAARKTRFHLVVVVSSSKTSYGQVYLDDGETLDISGQNEPWTLVSFYGA
LQKNSVFVASNVTNGRFALDQRWIIEKVTFLGIPKHKRISYMNGTGSLKMVVKTHNDDSS
QFVTIQVSELSLLIGEEFKLEIEI
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtaggcatgagagaagagacactatgcttcccttgttattgttcttgtgcatc
atatttaggcatggagttgaagcttccacactaacagaagaagtagttggatatggctac
accatctcaactgtggccagtgatcactttgggaagtcgttgactgccactcttagcctc
atcaaatcttcttctctccatggacctgacatcccacaactcaaactctctgccagtttt
gagaacaaggataggctaagagtaagaataacagactctacccaccaaagatgggagatc
ccagaagaagtgattcctagaggttcctattaccctcactgctctctcagcaccaaacaa
ttcccttctaaacaagaagtaaaactatctctgacaatagcaaactcagacctcatattc
agcctccacaacaccaccccatttggcttcactatctcgcgcaagtcctccaaggacatc
ctctttgatctttatggccttggtgaacacaccaagagatcctttaagttgcagccacac
cagacactcaccatgtggaattcagatacttttagtgccattcttgacttgaacctttat
ggttctcaccctttctacatggatgtaaggaaagggtctaaagatggaagagtgaagtcg
gggagcacacatggggtgttgcttttaaatagcaatgggatggatgttgcatatggtggc
gaccgtataacttacaaggtgattggtggagtgtttgatctttactttttttctggatca
tcgccggagctggtgatggagcagtacactgaactcattggaagacctgctcctatgcct
tattggtcttttggttttcatcagtgtagatggggctacaagaatgtaagtgatctcaag
ggtgtggttgccaactatgcaaaagcaaacataccccttgaagttatgtggacagatatc
gattacatggatgcatatcaagatttcacccttgatcctatcaactttccactggataag
atgaaaacatttgtggatacccttcacaaaaatggccagaaatatgtgcttatcttggat
cctggtatccatgtgaatcaaacatatgcaacttttgtcagaggattgcaggatgatata
tacatcaagagaaatggagtcaattaccttggtcaagtttggcctggaccagtttactac
cctgatttcttgaatccaagcagccaaaagttttggggtacggaaatcaaattatttaga
gagcttctcccatttgatggtatttggcttgacatgaatgagttgtctaatttcatcact
tctcccccgaatccatcgtctagtcttgacaaccctccctataaaattaataattccgga
gttatgcaacagatcaattacagaacagtcccggcaacatctttacattttggcaatatc
actgaatatgattcccataatttatatggactcttagaatccaaagcaaccaacaaggtt
ttaaaggatataagtggcaaaaggccattcattctaagtagatcaacttttgttagttct
ggcaagtacacagctcactggacaggagataatgctgccacatggaataatttagcatac
tcaatcccttctattttaaattttggaatatttggaattccaatggttggagcagatata
tgtggcttttcgggaaatacaactgaagaactttgtaggcgctggatccagctgggggct
ttttatccctttgcaagagatcattcggacaacacttccaataggcaagagctatatctt
tgggattcagttgctgaatcggctaggaaagtgctcggcctgcgctatcgcctcctccct
tatctttacacactaatgtatgaggcacacacaaaagggacaccaattgcaagacccctt
ttcttttcatttcctgaggatgtcacaacatatgatataagttcacagtttcttctagga
aagggggttttagtgtcacctgtactaaagccgggggctataacggttgatgcatacttc
ccagtaggaaactggtttgatctcttcaatttctcgaattcagtgagtgctgaatcagga
aaatatgttacccttgatgctccatctgatcacataaatgtgcatgttggtgaaggtaac
atcttggccatgcaaggagaggcattgacaacagaagccgcccggaagacccgatttcat
cttgtggtggttgttagtagcagcaaaactagctatggacaagtttatttggatgatggg
gagacacttgacatatcaggacagaatgagccatggacattggttagtttttatggtgca
ttgcagaaaaatagtgtttttgttgcatctaatgtcactaatggaagatttgccctggac
caaagatggatcatagaaaaggtcactttcttgggaatacctaagcataagagaataagt
tatatgaatggaacaggttcactgaagatggttgtcaagactcacaatgatgactcctca
cagtttgttactatacaagtttcagaattgtcactgcttattggagaggaatttaagctt
gaaattgaaatataa

DBGET integrated database retrieval system