KEGG   Arachis ipaensis: 107642394Help
Entry
107642394         CDS       T04301                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
aip  Arachis ipaensis
Pathway
aip00310  Lysine degradation
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107642394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aip03036]
    107642394
Enzymes [BR:aip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107642394
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107642394
Chromosome and associated proteins [BR:aip03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107642394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107642394
NCBI-ProteinID: XP_016201217
LinkDB All DBs
Position
B05
AA seq 351 aa AA seqDB search
MADSMLRVENIAGKGRGLVASQALKAGQVILTEPPLILYSSSPLTSSSSYCDHCFRTLPP
TLLSCPSCLNHHFCSNKCFSTSLNSSHSSTVCQALLSLQHSPLLQQHHQVQARFVVALHN
LAVSEINTLLSLHGTPDDSILQDANFLHDLISPLFPNIKLSVDLVAQALAKDRINSFCLM
EPYNPNGPQRSIKAYGIYPKATMFNHDCVPNACRFDYMNTTYTDTNTNHIVIRLIKDVDE
GEEICISYFRIGRDYATRKRILMEDYGFVCGCERCKVEASWSNNDENEDHDHVPHVRFLK
KHVCNIKNCGGTLAPVPPKHDAPFNNNVLECNFCGNFKIDDDDDDDDDDVI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcaatgttgagggtggagaatattgcaggaaaaggaagaggccttgtagcc
tctcaagctctcaaagctggccaagttatcctcactgaaccccctctcattctctattct
tcttcccctcttacttcttcttcttcttactgtgatcactgcttcagaaccctacctcct
actcttctttcatgtccttcttgtctcaaccaccatttctgcagcaacaagtgcttctct
acttccctcaattcctctcattcctccactgtttgccaagcactcttatcacttcaacat
tcaccactgcttcaacaacaccatcaagtgcaagcgcgttttgttgttgctcttcacaac
cttgcagtttctgagatcaacactctgctttctctacatggcaccccagatgattctatc
cttcaagatgcaaactttcttcatgatctaatctcacccctttttcccaacatcaagctt
agtgttgatcttgttgctcaggctcttgcaaaggacaggatcaattccttctgcttgatg
gagccttataaccctaatggacctcagagatcaattaaggcatatgggatatacccaaaa
gccacaatgtttaaccatgattgtgttcccaatgcttgcaggtttgattatatgaacact
acttatactgatactaatactaatcacattgttataaggttgattaaggatgttgatgaa
ggagaagagatttgcataagctattttaggattgggagggattatgctacaaggaagagg
atcttgatggaggattatgggtttgtttgtgggtgtgagaggtgcaaggttgaagcaagt
tggagcaataatgatgagaatgaagatcatgatcatgtgccacatgtaaggtttcttaag
aagcatgtttgtaatatcaagaattgtggtggcactttggcacctgttcctccaaaacat
gatgcaccgtttaataataatgttcttgagtgtaatttttgtggcaatttcaaaattgat
gatgatgatgatgatgatgatgatgatgttatataa

DBGET integrated database retrieval system