KEGG   Arachis ipaensis: 107642447Help
Entry
107642447         CDS       T04301                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aip  Arachis ipaensis
Pathway
aip00630  Glyoxylate and dicarboxylate metabolism
aip00710  Carbon fixation in photosynthetic organisms
aip01100  Metabolic pathways
aip01200  Carbon metabolism
Module
aip_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aip_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aip_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    107642447
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107642447
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     107642447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 107642447
NCBI-ProteinID: XP_016201295
LinkDB All DBs
Position
B01
AA seq 220 aa AA seqDB search
MQLSTFKCPQFTKYYHLSASPFIPLYYSFLHNFISASFKIRSTFSLRNMYAGSFAAPVSG
AGYVGLKANSSNLYTTTTTNIEWCKKKNIVSNGSKTHCMKTWNPINNRKFETLSYLPPLS
DESIGKEIDYMLKKGWTPCLEFDEVGYIRRENSRMPGYYDGRYWTLWKLPFFGCTDSSQV
MNEIKECKEQYPNAYIRCLAFDDHRHMQAMAFLIHKPPST
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcaactctccactttcaagtgcccacagtttactaaatactatcatctttcagcatct
cccttcattccattatattattcttttcttcacaacttcatcagtgcctccttcaagatc
agatcaaccttcagtttgagaaacatgtatgctggaagttttgcagctccggtttctggg
gctggctatgttggtttaaaggccaattcttcaaatctttatactactactactactaac
attgaatggtgcaagaaaaagaacatagtctccaatggctccaaaactcactgcatgaag
acatggaatccaatcaataataggaagtttgagacactgtcatacctgcctccactttca
gatgagtccattggaaaggagattgactacatgctgaagaaaggatggactccttgcctt
gaatttgatgaggtagggtatattagaagagagaacagcagaatgccagggtactatgat
ggaagatattggacactgtggaagctaccattttttggttgcactgattcatcacaagta
atgaatgagatcaaagagtgcaaagagcaatacccaaatgcttatataagatgtttggct
tttgatgatcatcgccacatgcaagccatggcttttctcatccacaaacctccttccact
taa

DBGET integrated database retrieval system