KEGG   Arachis ipaensis: 107642743Help
Entry
107642743         CDS       T04301                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aip  Arachis ipaensis
Pathway
aip00562  Inositol phosphate metabolism
aip01100  Metabolic pathways
aip04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107642743
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107642743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aip01009]
    107642743
Enzymes [BR:aip01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107642743
    3.1.3.48  protein-tyrosine-phosphatase
     107642743
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107642743
Protein phosphatases and associated proteins [BR:aip01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107642743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase CDKN3 Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 107642743
NCBI-ProteinID: XP_016201692
LinkDB All DBs
Position
B05
AA seq 600 aa AA seqDB search
MEQQQASADSSSTKEPTPLASNTETKTHSSKQVSVQSATAHDSPSILPASGISSWAKNLK
LRHSFSPQAENNGGSAFARLTSNLSLKLRPPSNEAAPATNSGSEQPNLIESFTKGLMDSS
KSAVKAVQVKARHMVSQNKRRYQEDGFDLDMSYITENIIAMGFPGGDISSGIFGYIEGFY
RNHMEEVIKFFETHHKGKYKVYNLCAERLYDGSLFQGKVATFPFTDHNCPPIQLIASFCE
SAHSWLKEDIQNVVVVHCKAGMGRTGLMICSLLLFLKFFPTAEEAIDYFNQKRCIDGKGL
TLPSQIRYVKYFERTLKQFNGEVPPGRRCMLRGFRLHNCPYWVRPSITISDHSGILFSTK
KHPKTKDLMPEDFWISIRKKGVVVFALPGEPGLTELVGDFKIHFNDGQGDFYCWMNTTMT
ENRTILDGSDLDGFDKRKIPTPGFQVEVVMVDYDGTVPARTKAGPASTEPEGNTNKVQAG
AKLASKSKVPKNGDDDDVFSDSDEEKDRQSGKSETEYKLAAPQGSGDTSDHVGVLTHSTN
QLRLHEERKQNNASQESTTDNNIHASGNTTNIESVGASEIKAIAADASVFAFGDEDFESD
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacaacaagcatctgctgattcatcatcaacaaaagaacctactcctttggct
tccaacactgaaacgaaaactcactcctcaaaacaagtctctgtacaatctgctactgct
catgattcaccatccattttgcctgcttctggaatatcgtcttgggcaaagaatctgaaa
ctccgacactcgttttcgccgcaggccgaaaataacggcggatcggcctttgctcgcctc
actagtaatctaagtctaaaactgcgaccgccgtcgaatgaggctgctcccgctactaat
tcaggcagtgagcagcctaatttaattgaatcattcaccaaagggttgatggactcttcc
aagagtgcagttaaggcagtgcaggtcaaagctcgccatatggtctctcaaaataaacgt
agataccaggaagatggatttgatttggatatgtcatacatcactgaaaatataattgct
atgggatttccaggcggtgatattagctccggaattttcggatacattgaggggttctat
cggaatcacatggaagaagtaatcaaattctttgaaactcaccataagggaaagtacaaa
gtatacaatctttgtgcagagaggttatatgatggatcgctattccaggggaaggttgcg
actttcccgtttacagatcataattgccctcctattcaacttatagcctcattttgtgaa
agtgcacattcatggttgaaggaggatattcaaaatgtagtagttgttcattgtaaagct
ggtatggggaggacaggattaatgatttgcagccttcttttatttctgaagttcttccca
actgcagaggaagccatagattacttcaaccagaaaagatgtatagatggaaagggctta
actcttcctagtcaaatcagatatgtcaaatattttgaacggactttgaaacaattcaac
ggcgaagtcccacctggacgaaggtgcatgctaagagggtttcggcttcataattgccct
tattgggttaggccatcaattacaatatctgatcatagtggaattctattcagcacgaaa
aagcatccaaagacaaaggatctaatgcccgaagatttctggatcagtatacggaagaaa
ggagtagtagtttttgcactaccgggggagcctggtttgacagagttggttggggacttc
aaaattcacttcaatgatgggcagggagatttctactgttggatgaatacaacaatgaca
gaaaatcgaaccattttagatggctcggatctcgatggctttgacaagagaaagatcccc
actccaggattccaggtcgaggttgtgatggtcgactatgatggcaccgtaccagcaaga
accaaagccggtcctgccagcacagaacccgaaggcaacacaaacaaggtccaagctggt
gcaaaacttgcgtcgaagagcaaggtccctaagaatggagatgatgatgatgtattctca
gatagtgatgaagagaaggatagacagagcggaaaatctgaaactgaatataagttagcg
gcacctcaaggatctggggatacttcagaccatgtaggagtgttgacacattcaacgaat
cagttgcgcctgcatgaggaacgtaagcaaaacaatgcttctcaagaatcaacaacagat
aataatattcatgcatccggtaacaccaccaacatagagtctgtaggggcaagtgaaatc
aaggcaattgctgcagatgcttcggtttttgcttttggagatgaagattttgaaagtgat
tga

DBGET integrated database retrieval system