KEGG   Arachis ipaensis: 107642871Help
Entry
107642871         CDS       T04301                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aip  Arachis ipaensis
Pathway
aip00020  Citrate cycle (TCA cycle)
aip00190  Oxidative phosphorylation
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107642871
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107642871
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107642871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 107642871
NCBI-ProteinID: XP_016201855
LinkDB All DBs
Position
B05
AA seq 631 aa AA seqDB search
MWRCVARRLRVPPPSDGSTPNHSLRSHFSRFFSSGENSSYTVVDHKYDAVVVGAGGAGLR
AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGD
QDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADR
TGHALLHTLYGQAMRHNTQFFVEYFALDLIMNSDGSCQGVIALNLEDGTLHRFQAASTIL
ATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGE
GGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPD
VLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVP
GLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLESDAGQKTI
AWLDKLRNSNGSLPTAKIRLNMQRIMQNNAAVFRTQDTLAEGCQLIDKAWESFHDVKLED
RSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYW
EKEKVRLDYRPVHMNTLDDEVESFPPKARVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtcgctcgtcgacttcgtgttcctccaccctccgacggatccacacct
aatcactctcttagatctcacttttctagattcttctctagcggagagaactcgtcgtac
acggtggtggatcataagtatgatgctgttgtggtaggtgctggtggcgctgggttgaga
gctgctattggactttccgagcatggattcaacactgcttgcatcaccaagctcttccca
actcgttctcacactgttgcagctcagggcggtataaatgctgcattgggaaatatgact
gaagatgactggaggtggcacatgtatgacactgtcaagggaagtgattggctaggagat
caagatgccatccagtatatgtgtagggaagcaccaaaagcagtcattgagcttgagaat
tatggattaccattttcccgtacagaggatggaaaaatatatcagcgtgcatttggtggt
caaagcttgaactttggaaagggtggtcaagcctaccgatgtgcatgtgccgctgatcga
actggacatgctttgttgcacactctttatggccaggctatgagacataatacacagttt
tttgtggagtattttgcattggaccttataatgaatagtgacggaagttgccaaggagta
attgccttgaatttggaggacggaacattacatcggtttcaagctgcttcaacaattttg
gcaacagggggttatggtagagcatatttttccgcaacctctgcacatacatgtactgga
gatggtaatgccatggttgcacgtgctggactccctctcgaggatttggagtttgtgcag
tttcacccaacaggtatatatggagcaggttgccttatcacagaaggttcccggggtgaa
ggtggaattctaagaaatagtgaaggtgagcgatttatggaacgatatgctcccactgca
aaggatcttgcatcaagagatgtagtttcaagatcaatgactatggagattcgggaaggt
cgtggtgtaggacccttgaaagatcacatctatctccacttgaatcacttacccccagat
gtgctcaaggagagacttcctggaatatcggaaacagctgctatttttgctggtgtggat
gttacaaaggaacccattcctgttttgcccactgtgcattataacatgggtggtatacct
acaaactatcatggagaggtggttaccattaaaggtgacaacccagatgcagtagttcct
ggattgatggctgctggagaagcagcttgtgcgtcggtgcatggagccaataggcttggt
gccaattcgcttctggatattgtagtttttggcagagcttgtgcaaatagggttgcagaa
atccataggccaggagaaaaacaaaaacctttagagagtgacgctggtcagaaaacaatt
gcctggctggacaagttgagaaattcaaatggttcattgccaacagcgaaaattaggtta
aatatgcaacggataatgcaaaataatgctgctgtattccgtacacaagacacattagca
gaaggttgccaattaattgataaagcgtgggagagcttccatgatgtcaagttagaggac
cggagtttaatttggaactccgacctgattgagactattgagttggaaaaccttttgatt
aatgcctgcatcacaatgcactcagctgaagccaggaaagaaagcagaggagctcatgcc
cgtgaggatttcacgaaaagagatgatgagaactggatgaaacacactttggggtattgg
gagaaggagaaggtccggttggactacaggccggtgcacatgaatacactagatgatgag
gttgagtcattccctcccaaagctcgtgtgtattaa

DBGET integrated database retrieval system