KEGG   Arachis ipaensis: 107644015Help
Entry
107644015         CDS       T04301                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
aip  Arachis ipaensis
Pathway
aip00071  Fatty acid degradation
aip00592  alpha-Linolenic acid metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
aip01212  Fatty acid metabolism
Module
aip_M00087  beta-Oxidation
aip_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107644015
   00592 alpha-Linolenic acid metabolism
    107644015
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107644015
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     107644015
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107644015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH
Motif
Other DBs
NCBI-GeneID: 107644015
NCBI-ProteinID: XP_020960887
LinkDB All DBs
Position
B01
AA seq 291 aa AA seqDB search
MKKLKQISVPVWEYLDRFDPAPIAQGSSRMNLRPTPSVGSGQSTSTNLGVLTGVSVETMA
AATSGTTARLFNTIVLLVCVPPCKFCGLFDGVNLSFARRLQDLAGYGVAVAVSKEFEGSF
RGLTYKSPLLDLMIKSGRNGKNNGKGYYIYEKGSKPKPDLSILPIVEESRRLANIMPGGK
PISITDQEIVEMILFPIVNEACRVLDEGIVIRASDLDIACVLGMSFPNYRGGVVFWADLV
GAKHVYNSLKKWSELYGNFYKPSRYLEERAIQGIPLVRLYICYYLFEFHGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgaaacagatcagtgttccagtttgggaatatcttgataggtttgatcca
gctccaatagcacaaggctcaagtcgaatgaacttacggccaaccccatctgttggttcg
ggtcaatctacttcaacgaacctaggtgtattaacaggagtatcagttgagaccatggct
gcagcaacttcagggactacagcaagactttttaacactattgttttgttagtatgtgtg
ccaccgtgtaaattctgtggtctgtttgacggagttaatctttccttcgcccgcaggctt
caggacttggctggctatggagtagctgtagccgtttccaaagaatttgagggttcattt
cgtggtctcacatataaatctccactgcttgatcttatgatcaaaagtgggagaaatggc
aaaaacaatgggaaaggatactacatttatgaaaagggtagcaagccaaaacccgatctt
tcaatactaccaattgttgaagagtcgagaagacttgccaatattatgcctggtggaaag
cctatatctattactgaccaagagattgtagagatgatcctctttccaatagtgaacgag
gcatgccgtgtattagatgaaggaatagttattcgagcatcagaccttgacattgcttgt
gttcttgggatgagcttcccaaattacaggggtggcgttgttttctgggcggacttggtt
ggggcgaagcatgtatataacagcctaaagaaatggtcagaattatatggtaacttctat
aagccatcaaggtatctggaggaaagggcaattcagggcattcctttggtaagactctat
atctgttattatctatttgaatttcatggaacttag

DBGET integrated database retrieval system