KEGG   Arachis ipaensis: 107644071Help
Entry
107644071         CDS       T04301                                 

Definition
(RefSeq) glutamate decarboxylase isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aip  Arachis ipaensis
Pathway
aip00250  Alanine, aspartate and glutamate metabolism
aip00410  beta-Alanine metabolism
aip00430  Taurine and hypotaurine metabolism
aip00650  Butanoate metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Module
aip_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107644071
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107644071
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107644071
   00430 Taurine and hypotaurine metabolism
    107644071
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107644071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107644071
NCBI-ProteinID: XP_016203343
LinkDB All DBs
Position
B05
AA seq 501 aa AA seqDB search
MVITSAVTDPEEQTQSLHSTFASRYVRDPIPRFKMPEKCIPKDAAYQIINDELMLDGTPR
LNLASFVTTWMEPECDKLIMASLNKNYVDMDEYPVTTELQNRCVNMIAHLYHAPIGEDEA
AVGVGTVGSSEAIMLAGLAFKRKWQAKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVE
LKEVKLTEGCYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKLLNELLTKKNKETGW
NTSIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSKDDLP
EELVFHINYLGSDQPTFTLNFSKAGSSQIIAQYYQFIRLGTEGYKNIMENCRENARILRE
GIEKMGRFNIVSKDVGVPLVAFSLKDSSQHTVFEVSDHLRKFGWIVPAYTMPPDAQHIAV
LRVVIREDFSRGLAERLVSDIVKVVDLLDTLPSPLSTKKAHVVAVANNETSEKAKKSALE
TQKEIALYWKRLVDGKRVGAC
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcacctccgctgtcacagatcctgaagaacaaacacaaagcttgcactctact
tttgcttccagatatgttcgtgaccctattcccaggttcaagatgccagagaagtgtata
ccaaaggatgcagcatatcagatcataaacgatgagttgatgttggatggaacaccaagg
cttaacttggcatcttttgtgaccacttggatggagcctgagtgtgataagctcatcatg
gcttcgcttaacaagaactatgttgacatggatgagtatcctgtcaccactgagctccag
aataggtgcgttaatatgatagcgcacctataccatgctcctattggtgaggatgaggct
gcagtcggtgtgggaaccgtcggatcatcagaggcaataatgttggcaggtctagctttt
aaaaggaaatggcaggcaaagagaaaagcagaaggcaaaccttatgataagcctaacata
gttaccggcgctaatgtgcaggtttgttgggagaagtttgcacggtattttgaggttgag
cttaaggaagtgaaactcacagaaggatgctatgtgatggaccctgtgaaagcagttgaa
atggttgatgagaacaccatctgtgtggcggcgattttggggtcgacactcaccggagag
tttgaagatgtgaagcttcttaatgagcttcttactaagaagaataaggagacaggatgg
aatacctcgattcatgttgatgctgccagcggagggttcattgccccatttctctaccct
gatcttgagtgggattttcgcttaccattagtgaagagcatcaatgttagtggtcataag
tatggtcttgtctaccccggtgtcggttgggttgtttggaggagtaaagatgacttgcca
gaggaacttgtttttcacataaactatctcggatcggatcagccaacatttaccctcaat
ttctccaaagcaggctctagtcaaattattgctcaatattaccaatttatacggcttggc
actgagggctacaaaaatatcatggagaactgcagggagaatgcaagaattctgagggag
ggaattgagaaaatgggccggttcaatatcgtctctaaggacgttggcgtgccgcttgtc
gccttctctttgaaagacagcagccaacacacagtgtttgaggtgtcagaccatctgaga
aaatttggctggatagttccggcctacacaatgccgccagacgcgcagcacattgcggtc
ctccgggtggtgatcagggaggatttcagccgcggattggcggagagactcgtgtccgac
atagtgaaagttgtggatctcttggacacacttccaagccctctatcaacaaaaaaggca
catgtggtagctgttgctaataatgagacaagtgagaaggctaagaagagtgcattagag
actcagaaagagattgccttgtattggaagaggcttgtggatggcaaaagagttggagca
tgttag

DBGET integrated database retrieval system