KEGG   Arachis ipaensis: 107644762Help
Entry
107644762         CDS       T04301                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aip  Arachis ipaensis
Pathway
aip00040  Pentose and glucuronate interconversions
aip00051  Fructose and mannose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107644762
   00051 Fructose and mannose metabolism
    107644762
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107644762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Pyr_redox Pyr_redox_3 BON UDPG_MGDP_dh_N PALP FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 107644762
NCBI-ProteinID: XP_020958852
LinkDB All DBs
Position
B05
AA seq 365 aa AA seqDB search
MVIINTEMSQSEDEEINMAAWILGVKDLSIQPYPLPSLGPHDVKIRIKAVGICGSDVHYY
KTMRCANFIANKPMVLGHECAGIIQELGTQVQSLAVGDRVALEPGISCQTCNFCKGGRYN
LCRGMKCFGSASTHTHGSLANMVVHPANLCFKLPDNVSLEEGAMIEPLSVGVHACRRANI
SPDTNVLIIGAGPIGLVVSLAARAFGSPRIVMVDVDNTRLSIAKDLGADETILVSTSIQD
MEKEVVQIQNAMRSKIHVSFDCVGYNKTMSTSLNVTTSGGKVCLIGLAQTEMTVPLTPAA
AREVDVIGIFRYRNTWPLCIELLRTGKIDIKPLISHRFGFSQKELEEAFETSARGGNAIK
IMFNL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtgataattaacacagaaatgtcacaaagtgaagatgaagagatcaacatggcagct
tggattcttggtgttaaagatttatcaattcaaccatatccacttccttctttaggtccc
catgatgttaaaattagaattaaagctgttggtatttgtggaagtgatgttcattactat
aagactatgagatgtgcaaattttattgccaacaagcctatggtactggggcatgaatgt
gctggaatcattcaagaactaggcactcaagttcaatctcttgcagtaggggacagggta
gccttagagcctggaatcagttgccaaacatgcaatttctgcaaaggtggccgctacaat
ctctgtcgcggcatgaaatgttttggatcagcatcaactcacactcacggttctcttgcc
aatatggtggtgcatcctgccaatctgtgtttcaagctacctgacaatgtgagcttggag
gaaggagccatgattgagccactcagtgtaggagtgcatgcgtgtcgtcgcgcgaatatc
agtccagacacaaatgtactaatcataggagcaggaccaattggccttgtagtatcactt
gctgccagggcatttggatcaccaagaattgtgatggttgatgttgataacactcgttta
tcaattgcaaaagatcttggtgcagatgagactattctagtttcaactagtatccaggac
atggagaaagaagtggtgcaaatccagaatgccatgaggtctaagattcatgtgagtttt
gactgtgttggctacaataaaaccatgtccacatcactcaatgtcaccacctctggtggc
aaagtttgcctcattggattagctcaaactgagatgacagttccccttactccggccgca
gcgagggaggttgatgtaattggaatattcagatacagaaacacttggcccctatgcatt
gagctattaagaactgggaagattgacatcaagccattgataagtcacaggtttggattc
tcacagaaagagttggaagaagcctttgaaaccagtgctcgagggggaaatgctattaag
atcatgttcaatctctag

DBGET integrated database retrieval system