KEGG   Arachis ipaensis: 107644763Help
Entry
107644763         CDS       T04301                                 

Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aip  Arachis ipaensis
Pathway
aip00040  Pentose and glucuronate interconversions
aip00051  Fructose and mannose metabolism
aip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107644763
   00051 Fructose and mannose metabolism
    107644763
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107644763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N Pyr_redox_2 NCD3G PALP Methyltransf_25 Pyr_redox_3 Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-GeneID: 107644763
NCBI-ProteinID: XP_016204175
LinkDB All DBs
Position
B05
AA seq 363 aa AA seqDB search
MGKGGMSVDDDHGEEQNMAAWLVAINTLKIQPFNLPPLGPHDVRVRMKAVGICGSDVHYL
KTLRCAHFVVEEPMVIGHECAGIIEEVGSEVKALVPGDRVAIEPGISCWRCDHCKQGRYN
LCPDMKFFATPPVHGSLANQIVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRAEIGP
ETKVLIMGAGPIGLVTMLAARAFGAPRIVIVDVDDHRLSVAKSLGADDIVKVSTNSQDVP
GEVEQIHKAMGADVDVTFDCAGFNKTMTTALSATKPGGKVCLVGMGHSEMTVPLTPAAAR
EVDVIGIFRYKNTWPLCLEFLRSGKIDVKPLITHRYGFSQKEVEEAFETSAAGGNAIKVM
FNL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggagggatgtcagtagatgatgatcatggagaagagcagaacatggctgct
tggcttgttgccattaacacactcaagattcagccattcaaccttcctcctcttggaccc
catgatgttagagttagaatgaaagctgttggtatatgtggaagtgatgttcactacctc
aagacactgagatgtgcacactttgtagttgaagagccaatggtgattggtcacgagtgt
gctgggatcattgaagaagttggcagtgaggtcaaggccttggtgccaggtgaccgtgtg
gcgattgagccaggaatcagttgctggcgttgcgaccactgcaagcagggccgctataac
ttgtgccctgatatgaagttctttgccactccaccagttcatggttcccttgctaatcag
atagtgcaccctgcagacctatgttttaaactaccagacaatgtaagcttagaggagggg
gcaatgtgtgagcccttaagcgtcggtgttcatgcttgtaggcgtgctgagattggccca
gaaacaaaggtgttgatcatgggagctggacctataggacttgttacaatgcttgcggct
cgagcttttggcgcgcctaggattgtcatagtggatgtcgatgaccatcgtttatctgtt
gcaaaatctcttggtgctgatgatattgtcaaagtctcgacaaactcccaggatgttcct
ggagaagttgaacagatacataaggctatgggagctgatgtagatgttacctttgactgt
gccggtttcaacaaaaccatgactacagcattgagtgctactaagccaggtggcaaagtt
tgcttagtaggaatgggtcattctgaaatgacagtcccactcaccccagctgctgcaagg
gaagttgatgtgattggtatattccggtataagaacacatggcctctatgtcttgagttt
ctaaggagtggcaaaatcgatgtgaagccccttataacacacaggtatggattctctcag
aaggaagtggaagaagcatttgaaacaagtgctgctggtggtaatgctattaaggtcatg
ttcaatctttag

DBGET integrated database retrieval system