KEGG   Arachis ipaensis: 107645856Help
Entry
107645856         CDS       T04301                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aip  Arachis ipaensis
Pathway
aip04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aip00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107645856
Enzymes [BR:aip01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107645856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107645856
NCBI-ProteinID: XP_016205468
LinkDB All DBs
Position
B06
AA seq 152 aa AA seqDB search
MVKAVAVLSSSEGVSGTIQFSQEGNGPTTVTGNLAGLKPGLHGFHVHALGDTTNGCLSTG
PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVSFSISDSQIPLSGPNSIVGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgtggcagttcttagcagcagtgagggtgttagtggaactattcaattc
tctcaggaaggaaatggtccaaccactgtgactggaaatcttgctggccttaagcctggt
cttcatgggttccatgtccatgcccttggagacaccacaaatggttgcctgtcaactgga
ccgcatttcaatcctaacaacaaggagcatggtgcccctgaagatgagaaccgccatgct
ggtgatttaggaaatgttaatgttggagatgatggaactgttagcttctccatttccgac
agtcagatccctcttagtggaccaaactccattgttggaagggctgttgttgtccatgct
gatcctgatgatcttgggaaaggtgggcatgagcttagcaaatccactggaaatgctggt
ggcagagtagcttgtgggattattggtttgcaaggctag

DBGET integrated database retrieval system