KEGG   Arachis ipaensis: 107646291Help
Entry
107646291         CDS       T04301                                 

Definition
(RefSeq) ABC transporter G family member 15-like
Organism
aip  Arachis ipaensis
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane ABC_tran AAA_21 AAA_29 RsgA_GTPase AAA_33 Rad17 AAA_25 AAA_16 MMR_HSR1 PDR_CDR AAA_22 AAA_23 AAA_5 SMC_N AAA_30 Dynamin_N NACHT AAA_17 AAA_18 RNA_helicase Cytidylate_kin
Motif
Other DBs
NCBI-GeneID: 107646291
NCBI-ProteinID: XP_016205968
LinkDB All DBs
Position
B06
AA seq 695 aa AA seqDB search
MCISMVDSPAMELHAEVMENENNNVVIRREVCLVWEELTVVINSGKSSNNSERRKKVLNG
ISGYAEPNRIMALIGPSGAGKSTFLDALAGRLASNVSITGNVLLNGTKRTTSSRDLSYVT
QEDHFLGTLTVRETLTYAAYLRLAANMASDEIDKVVAKTLDEMGLQDCAESRLGNWHSRG
ISKGEKRRLSIGIEILTQPHILLLDEPTSGLDSAAAFFVISSLRSIAHDGRIVICSIHQL
SSEVFNLFDDMVILAGGETVYFGERTKAVKFFEDAGFPCPTRKNPPEHFLRCISPEFDSV
LTLIQSKNANNEAPSSWNSLMNMTTEEIKWKLINCFKNSRQLANAREKIREIKLRKEPPI
ERAYDTRTLKQLCTLTHRSFLNMTRDIGYYWLRILFYMLVSVCAGFLYLNVGTSNSAILS
RSKIDGFIYGFMIFLCIGGLPFFLEDLKVFERERFGRHYGEAVYVLSSFISSLPFVVFIS
LTSGTTLYHMVNFHPGFSHYCYFCINLFCSISVTEGCMLLVAALVSNQLLAIGTSAAITI
LMMMPSNAFRRMIDIPKFFWRYPMSYISYIAWSIQGQYKNDLIGLEFEGMMPGDRKIKGE
VILEEMFGIRTDYSKWWDIGALVCLLISYRLMFFLVLKHRERASSLFHTILLTRSSLKLK
LNLNLNFNHKYIATKRHHSLYPFSSQHGFTSPIIS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatttctatggtggattccccagcaatggagttgcatgcagaagtgatggagaat
gaaaataataatgttgttattaggagggaagtgtgcttggtttgggaagaattgacagtg
gttattaacagcggcaagagcagtaataatagtgaaagaaggaagaaagtgttgaatgga
ataagtggatatgctgaaccaaacagaatcatggctctaattggtccttctggtgctggc
aaatccaccttccttgatgctcttgctggaagacttgcaagcaatgtcagcattactgga
aatgtgctactgaatggcactaagagaaccacatcctctagagatctttcttatgtaaca
caagaagaccatttcttaggaacactaactgtgagggaaacactcacatatgctgcttat
ctgagacttgctgcaaacatggccagtgatgagattgacaaggttgtagctaagacgctc
gacgaaatgggtcttcaagattgtgcagagagcaggcttgggaattggcattcaagagga
ataagtaaaggagagaagagaagactcagcattggcattgaaatcttaactcagcctcat
atacttttgcttgatgaacctaccagtggattggatagtgctgctgctttctttgtcatt
tcatctctcagaagcattgcacatgatggcagaattgttatttgctccattcaccaactt
agcagtgaagttttcaacctctttgatgacatggtgatcctcgcaggaggcgaaactgtg
tattttggagaaaggactaaagctgttaagttctttgaagatgcagggtttccttgtcca
acaagaaagaaccctcctgagcacttccttcgttgcatcagccccgaattcgatagtgtt
ctaactttgatacagtccaagaatgccaataatgaagcaccatcatcatggaattctcta
atgaatatgacaacagaggagattaaatggaaacttataaactgtttcaagaattctagg
cagttagcaaatgcaagggaaaagatcagagaaatcaaactaagaaaagaacctccaata
gagagggcatatgatactagaacactgaagcagctatgcacattgactcatagatcattc
cttaacatgaccagagacattggttactattggttaaggattctgttctacatgttagta
tcagtgtgtgctggttttctttatctaaatgtaggaactagtaatagtgcaatcttatca
agaagcaagattgatggattcatctatggcttcatgatctttctgtgcattggtggctta
cccttcttccttgaggacttaaaggtcttcgagcgcgaaagattcggaaggcattatgga
gaggcagtttatgttctttcgagtttcatctcgtcacttccttttgttgttttcatttcc
cttacttcaggaacaacactttaccacatggtgaattttcaccctggattctctcattac
tgctacttttgcataaacctcttctgcagcatttctgtcacagaagggtgcatgctttta
gttgctgctcttgtttccaaccagctccttgctattggaacatcagctgctataactata
ctgatgatgatgccatcaaatgcatttcgaagaatgattgacattccgaaattcttctgg
cgctatcccatgtcctacatcagttatatcgcttggtcaatacaggggcaatacaagaat
gacctgattggacttgaatttgaaggaatgatgccaggagacagaaagataaagggtgaa
gtgatacttgaagaaatgtttggaataagaacagattattcaaaatggtgggacatagga
gccttagtttgcttgttaatatcatacagattgatgtttttcttggttcttaagcatagg
gagagagcttcatcactatttcacaccattttactcacaagatcctccctcaaactcaaa
ctcaatctcaatctcaatttcaatcacaaatatattgctaccaagagacaccattcccta
tatcctttctcatctcaacatggatttacctctccaataatatcctag

DBGET integrated database retrieval system