KEGG   Achromobacter insolitus: BUW96_00250Help
Entry
BUW96_00250       CDS       T04671                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ais  Achromobacter insolitus
Pathway
ais00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01130  Biosynthesis of antibiotics
ais01230  Biosynthesis of amino acids
ais02024  Quorum sensing
Module
ais_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BUW96_00250
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BUW96_00250
Enzymes [BR:ais01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BUW96_00250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: APX73498
UniProt: A0A167AW66
LinkDB All DBs
Position
55131..56204
Genome map
AA seq 357 aa AA seqDB search
MSHNTDDLRIREIKELNPPAHVMREFACTKEASDTVFAARQGMHRILHGMDDRMIVVIGP
CSIHDTRAAIEYAKRLKPVRDRLSADLEIVMRVYFEKPRTTVGWKGLINDPDLDGSFDIN
KGVRVARELLLDINSLGLPAGCEFLDMITPQYIADLVSWGAIGARTTESQVHRELASGLS
CPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIVSTAGNEDCHVILRGGKTPN
YDAASVEAACQDMSKAGLAQRIMIDASHANSSKKPENQPLVIEDVARQMEAGDSRLVGVM
VESHLLGGRQDMVPGTPLVYGQSITDGCIDWDASVAVLERLAHAVRERRRVALTSGK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgtcacacaataccgacgaccttcgcattcgagaaatcaaagagctgaacccgcccgcg
cacgtcatgcgcgagttcgcctgcaccaaggaggcgtccgacactgtgttcgccgcccgc
caggggatgcaccgcatcctccatggcatggatgaccggatgatcgtcgtgatcggtcct
tgctccatccatgacacccgggcggccatcgaatatgcgaagcgcctgaagcccgtgcgc
gaccggctgagcgccgacctggaaatcgtgatgcgcgtttacttcgagaagccgcgcacc
acggtaggctggaagggcctgatcaacgatccggacctggacggcagcttcgatatcaac
aagggcgtgcgcgtcgcccgcgaattgctgctggacatcaacagcctgggactgccggcg
ggttgcgagttcctggacatgattacgccgcagtacatcgcggatctggtctcctggggg
gcgatcggggctcggacgacggaaagccaggtgcatcgcgagctggcttccggactgtcg
tgtccggtggggttcaagaacggcaccgacggcaatgtgaagatcgcggtggatgcgatc
aaggctgcatcgcagccgcaccatttcctgtcggtgaccaagggcgggcattcggccatc
gtgtcgaccgccggcaatgaggactgccacgttatcctgcgcggcggcaagacgccgaat
tacgatgcggccagcgtcgaggcggcctgccaggacatgtccaaggccggcctggcgcag
cgcatcatgattgacgccagccacgccaacagcagcaagaaacccgaaaaccagcccttg
gtcatcgaagacgtggcgcgccagatggaagcgggcgacagccgcctggtgggcgtcatg
gtcgaaagccacctcctgggcggtcgccaggacatggtgcccggcacgccgctggtatac
ggtcagagcatcacggacggctgcatcgactgggacgcgtccgtcgccgtgctcgaacgc
ctggcccacgctgtgcgcgaacgccgccgggtcgccctgacctctggcaagtaa

DBGET integrated database retrieval system