KEGG   Achromobacter insolitus: BUW96_07590Help
Entry
BUW96_07590       CDS       T04671                                 

Definition
(GenBank) autotransporter outer membrane beta-barrel domain-containing protein
Organism
ais  Achromobacter insolitus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autotransporter PATR Pertactin DUF3575
Motif
Other DBs
NCBI-ProteinID: APX74747
UniProt: A0A448JUI2
LinkDB All DBs
Position
1678971..1681787
Genome map
AA seq 938 aa AA seqDB search
MVNENCNRAGWSKWIILAAYAANSANPVSAQSVSSTGQVQPGPVQTPNWTVGSDLIVGDD
LAGTLTISDGGSVLNDWAFIGNFNGGVGSLTVSGRDGVGAPSTWTSLGPVYIGAESGSNG
EVRILAGGWADSALASIGVNNGSIGSVVVSGPGSSWNLATSNGFMIGEGGNGTLQIDNGG
AVHSGQALIGRGPGSQGSVTVLGPTSVWDPFNNIYVGFEGLGELRVLEGATVRTVGSSAP
GAAASIYIGNQAGGVGTVSVSSTTSNISTLRASDRIEIGSAGTGTLNIAKGGLAVADSDT
WVTVSSTATGTLNLVGDASGRGVLETGSVIKGAGNATFTLDGGVLRARRDKANFLNGFLT
QAIGSEGASFDTNGYEVGVMTAFSGTSSFNKLGAGRLTLSGDSSAFTGTTDIHAGTLQID
GVLGGPVNVLAGAWMTGTGRVGATVNRGTVAPGPRSGFGTITVAGNYTAQGGNLEIRTQL
GGDNSPTDKLVVTGDTAGATPVNVKNMGGAGALTQRGIQIVQVNGISAGQFNLANGDYVI
EGRPALVAGAYGYVLQQDSADGGWYLRSSLTDPGTPPTNPGTPPTDPGTPPTNPGTPPTD
PGTPPTDPGTPPAGGVSPGAPPPLLYQPGVPVYEAYANTLLNLSRLPTLRQRVGNRLYES
AYVGRNGVWSRMEGTTSRLEPSTSTTGARQDIDSWKAQFGVDRILAGQEEGSRLVGGIAV
YYGKADTHVFSVYGNGTIDTTAYGLTPTLTWYGKNGVYIDTQAQATWFDSDLKSRLAGKL
KGGSQANSYGLGIEAGKAFGLNERLALIPQAQLSYVSTRFDSFNDRFGAHIESDKGNSLL
ARIGIALDYKSNWQTAGVNRESSVYGVVNVKHEFLDGTRVRVADVPAASRMARTWGSVGA
GANYGWGDRYAIYGQIDADADFSGSYIVTATAGFRMMF
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaacgaaaattgcaatcgcgcggggtggtcaaaatggataatcctggcggcatac
gcggccaattctgccaaccccgtcagcgcgcaatcggtctccagcaccggtcaagtgcaa
ccaggcccggtccagacaccgaattggactgtcggaagcgatctgattgttggcgatgac
cttgccgggacattgaccatcagcgatggcggatccgtgctcaatgattgggctttcatt
ggcaacttcaatggcggcgtgggttccctcacggtgtcaggccgcgacggcgttggcgct
ccctccacttggaccagcctcggcccggtgtatatcggcgccgagtcgggcagcaatggc
gaagttcgcattctggccgggggatgggcagacagcgctttggccagcatcggcgtcaat
aacggcagcatcggaagcgttgttgtatccgggcctgggtcaagttggaacctcgctacg
agcaatgggttcatgattggcgagggcggtaacggcacgctgcaaatcgataatggcggc
gcggtgcatagcggccaggcactgatcgggcgcggccccggcagccagggcagcgtgacg
gtattggggccgacatccgtctgggacccgttcaacaatatctacgtcggtttcgagggc
cttggcgagctgcgcgtcctggaaggcgccaccgtgcgcaccgtcggatcgtcggcgcca
ggcgccgccgcatcgatctacatcggcaaccaggcgggcggcgtcggcacggtgagcgta
tccagcacgacctccaatatctcgacacttagggcaagcgatcgtatcgaaattggctcg
gcaggcacgggaaccttgaacatcgccaagggcgggctggcggtcgccgacagcgacacg
tgggtaaccgtaagcagcaccgccacaggcacgctgaaccttgttggcgatgccagcggc
cgcggcgtgctggagaccggctcggtcatcaagggcgccggcaacgccacctttaccctg
gacggcggcgtcctgcgcgctcggcgcgacaaggccaatttcctgaatggcttcctgacg
caggcgatcggaagcgagggagcctcgttcgacaccaacggctacgaagtgggggtgatg
accgcgttctcgggaacctccagcttcaacaagctgggcgccggcaggctgaccttgtcg
ggcgacagttccgccttcacgggaaccaccgatatccacgccggcacattgcagatcgat
ggcgttctcggcgggccggtaaacgtcctggcgggagcatggatgaccggcacgggacgg
gtcggtgcgacggtcaaccggggcaccgtcgccccggggccgcgcagcggcttcggtacc
atcaccgtcgcaggcaactatacggcccagggcgggaacctggagatccgcacccagctt
ggcggggacaactctccaacagataagttggtcgtcacgggcgacaccgcaggcgcgacg
cccgtcaacgtgaagaacatgggaggcgctggcgcgttgacccaacgaggcatacagatc
gtgcaggtcaacgggatctcggcgggacagttcaacctggcgaacggcgactatgtcatc
gaggggcgcccggccctggtggctggcgcctacgggtatgtcctgcaacaggactcggcc
gacggcggctggtatctgcgatcatccctgaccgaccctggcacaccgccaaccaatccg
ggtactccgccgacggatcccggcacaccaccgaccaatccgggcacaccgcctaccgat
ccaggtacccccccgacggatcccggcacaccgccggccggcggcgtttcacccggcgcc
ccaccgcccttgctgtatcagcctggtgtgccggtctatgaagcctacgccaacaccctg
cttaacctgagccgactgcccaccctgcgccaacgggtcggcaaccgcctctatgagtcc
gcgtatgtgggccgcaacggcgtatggagccggatggagggcacgacgagccggctcgag
ccttccacgtccaccacgggcgcgcgccaggatatcgacagctggaaggcgcaatttggt
gttgaccgtatcctggcgggtcaggaagaaggatcccgtctggtgggaggcatagccgtt
tactacggcaaggccgacacacatgtgttttcggtgtatggcaacggcacgatcgacacc
acggcctatggcctgacaccgaccctgacctggtatggcaagaatggcgtctatatcgac
acacaggcccaagcaacctggttcgacagcgacctgaagtcccggctggccggcaagtta
aagggcggcagccaagccaacagctatgggctgggtatcgaagcgggcaaggcgttcggg
ttgaacgagcggctggccctgatccctcaggcgcagctgagctacgtatcaacccgcttc
gacagtttcaatgacagattcggcgcgcacattgaaagtgacaaaggcaacagcctgctt
gcccgcatcggtatcgcgctggactacaaaagcaattggcaaactgcaggcgtgaatcgg
gaatcaagcgtctatggcgtcgtcaacgtgaaacatgaattcctggacggaacccgtgtg
cgcgtggccgacgtacccgcagccagccgcatggcgcggacctggggcagcgtgggcgcg
ggggcaaattacggttggggcgaccgctatgcgatttacggccagatcgacgccgacgcg
gatttctccggcagctatatcgtcaccgcgaccgcaggtttcagaatgatgttttag

DBGET integrated database retrieval system