KEGG   Achromobacter insolitus: BUW96_18255Help
Entry
BUW96_18255       CDS       T04671                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ais  Achromobacter insolitus
Pathway
ais00020  Citrate cycle (TCA cycle)
ais00190  Oxidative phosphorylation
ais00650  Butanoate metabolism
ais01100  Metabolic pathways
ais01110  Biosynthesis of secondary metabolites
ais01120  Microbial metabolism in diverse environments
ais01130  Biosynthesis of antibiotics
ais01200  Carbon metabolism
Module
ais_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ais_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ais_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BUW96_18255
   00650 Butanoate metabolism
    BUW96_18255
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BUW96_18255
Enzymes [BR:ais01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BUW96_18255
    1.3.5.4  fumarate reductase (quinol)
     BUW96_18255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA FAD_binding_3 Lycopene_cycl Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APX76608
UniProt: A0A167B1S3
LinkDB All DBs
Position
complement(4005117..4006895)
Genome map
AA seq 592 aa AA seqDB search
MVSVMKSLPRRQFDVVVVGAGGAGMRCSLQLSQAGLSVAVLSKVFPTRSHTVAAQGGVSA
SLGNMSEDNWYWHMYDTVKGSDWLGDQDAIEFMCREAPNAVYELEHFGMPFDRNPDGTIY
QRPFGGHTANFGEKPVQRACAAADRTGHALLHTLYQRNVAARTQFFVEWMALDLLRNEAG
DVVGVTALEMETGEIYILEAKTTVLATGGAGRIWAASTNAFINTGDGLGMAARAGIPLQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILLNKDGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPDGSYVVLKLDHLGADVINKRLPSIREIAIKFGNVDPIKEPIPVVPTIHYQ
MGGIPANYHGQVLTRENGENKIVNGLYAIGECAAVSVHGANRLGTNSLLDLIVFGRATGN
HIVNSHPERQHAHQPVPQQAVEFSMDRINKLESRTSGEKTQDIGNAIRFSMQRHCGVFRT
LELLNEGVTQIEDLAKQADNIYFKDKSKVFNTARVEALELANMTEVARATIKSAANRTES
RGAHALDDHPTRDDENWLKHTLWYSEGSRLDYKPVQMKPLTVESFPPKARTF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtggtctctgtcatgaaatccctgccgcgccgccagtttgatgtggtggtcgttggcgcc
ggtggagccggcatgcgttgttcgctgcaactgtcccaagcgggcctgtccgttgcagtg
ctgtccaaggtgttccccacgcgttcgcacacggttgccgcacagggcggcgtgagcgcc
tcgctgggcaacatgagcgaagacaactggtactggcacatgtacgacaccgtcaagggt
tcggactggctgggcgaccaggacgccatcgaattcatgtgccgcgaagcgccgaacgcc
gtgtacgagctcgagcacttcggcatgccgttcgaccgcaaccccgacggcacaatctac
cagcgtccgttcggcggccacaccgccaacttcggtgaaaagccggtccagcgcgcctgt
gccgctgccgaccgtaccggccacgcgctgctgcacaccctctaccagcgcaacgtcgcc
gcacgcacccagttcttcgtcgaatggatggcgctggacctgctgcgcaacgaagcgggc
gacgtcgttggcgtgaccgccctggaaatggaaacgggcgaaatctacatcctggaagcc
aagaccacggtgctggccaccggcggcgccggccgcatctgggccgcttccaccaacgcc
ttcatcaacactggtgacggcctgggcatggccgcccgcgcgggcatcccgctgcaggac
atggaattctggcaattccacccgaccggcgtggccggcgccggcgtgcttatcaccgaa
ggcgtgcgcggtgaaggcggcatcctgctgaacaaggatggcgaacgcttcatggagcgc
tatgcgcccacgctgaaggatctggccccgcgcgacttcgtgtcccgttcgatggaccag
gaaatcaaggaaggccgcggctgcggtccggacggcagctacgtggtcctcaagctggac
cacctgggcgccgacgtcatcaacaagcgcctgccctcgatccgcgaaatcgccatcaaa
ttcggcaacgtggacccgatcaaggaaccgatccccgtcgttccgaccatccactaccag
atgggcggcatcccggccaactaccacggccaggtgctgacgcgcgaaaacggcgagaac
aagatcgtcaacggcctgtacgccatcggcgaatgcgccgcggtgtcggtgcacggcgcc
aaccgcctgggcaccaactcgctgctggacctgatcgtgttcggccgcgccaccggcaat
cacatcgtcaattcgcatccggaacgccagcacgcgcatcagcccgtgccgcagcaagcc
gtcgaattctcgatggatcgcatcaacaagctggaatcgcgcacctcgggcgaaaagacc
caggacatcggcaatgccatccgcttctcgatgcagcgtcactgcggcgtgttccgcacg
ctggagctgctgaacgaaggcgtgacccagatcgaggatctggccaagcaagccgacaac
atctatttcaaggacaagtccaaggtgttcaacaccgcgcgcgtcgaggcgctggaattg
gcgaacatgaccgaagtggcccgcgccaccatcaagtcggccgccaaccgcaccgaaagc
cgcggcgcgcacgcgctggacgaccatccgacgcgcgacgacgaaaactggctgaagcac
acgctgtggtactccgaaggcagccgcctggattacaagcccgtgcagatgaagccgctg
acggtcgagtccttcccgcccaaggcgcgtaccttctaa

DBGET integrated database retrieval system