KEGG   Achromobacter insolitus: BUW96_19725Help
Entry
BUW96_19725       CDS       T04671                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ais  Achromobacter insolitus
Pathway
ais02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ais00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BUW96_19725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ais02000]
    BUW96_19725
Transporters [BR:ais02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BUW96_19725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N TniB AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: APX76864
UniProt: A0A167B7V7
LinkDB All DBs
Position
4328230..4329237
Genome map
AA seq 335 aa AA seqDB search
MQTQPVLRVRDLTTCFDGDETTVVAVDRLSFDLMPGETLGLVGESGCGKSVTSLSIMRLL
RAPGRVAGGNIEFDGQDLLALPEKSMRSIRGNQISMIFQEPMTSLNPVFTVGRQICESLM
LHQGMSRRAAMAQAESLLELVQISDPARRVREYPYQLSGGMRQRAMIAMALACQPKVLIA
DEPTTALDVTIQAQILHLLREIQQRLGTSIVLITHDLGVVAQMCQRVIVMYAGRKVEEGS
VDDILDRAQHPYTQALIRSLPDFAEGQDHTARLAELPGIVPVMTPQSRGCAFAARCPEAQ
PRCAEQAPSAADAGNRHRVWCWAREAAPASAALTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacccaacccgtcttgcgcgtgcgcgacctcaccacctgtttcgacggcgacgaa
accaccgtggtcgccgtggaccgcctgtcctttgacctgatgcccggcgaaacgctgggc
ctggtcggcgaatccggctgcggcaagagcgtcacgtccctgtccatcatgcgcctcctg
cgcgcccccggacgcgtggccggcggcaacatcgaattcgacggccaggatctgctggcg
ctgcccgagaagtccatgcgctcgatccgcggcaaccagatttcgatgatcttccaggag
cccatgacctcgttgaaccccgtgttcacggtcggccggcagatctgcgaatcgctcatg
ctgcaccagggcatgtcgcggcgcgcggccatggcgcaggctgagtcgctgctggagctg
gtgcagatctccgatccggcgcgccgcgtgcgcgagtatccctatcagctgtccggcggc
atgcgtcaacgcgccatgatcgccatggcgctggcctgccagcccaaggtcctgatcgcc
gacgagccgaccaccgcgctggacgtcaccatccaggcgcagatcctgcacctgttgcgc
gaaatccagcaacggctgggcacgtccatcgtgctcatcacccacgacctgggcgtggtg
gcacagatgtgccaacgcgtcatcgtgatgtacgccggacgcaaggtcgaagaaggcagc
gtggatgacatcctggaccgcgcccaacatccctatacccaggcgttgatccgttcgctg
ccggatttcgccgaaggccaggaccacacggcgcggctggccgaattgcccggcatcgtg
ccggtcatgacgccgcagtcgcgcggctgcgccttcgcggcgcgctgcccggaagcgcag
ccgcgctgcgccgagcaggcgcccagcgcagccgacgccggcaatcgccaccgcgtctgg
tgctgggcccgcgaggccgcccccgcgtccgccgcactgaccgcctga

DBGET integrated database retrieval system