KEGG   Achromobacter insolitus: BUW96_23165Help
Entry
BUW96_23165       CDS       T04671                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ais  Achromobacter insolitus
Pathway
ais00620  Pyruvate metabolism
ais00680  Methane metabolism
ais01100  Metabolic pathways
ais01120  Microbial metabolism in diverse environments
ais01200  Carbon metabolism
Module
ais_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BUW96_23165
  09102 Energy metabolism
   00680 Methane metabolism
    BUW96_23165
Enzymes [BR:ais01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BUW96_23165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APX77447
UniProt: A0A2Z5AS48
LinkDB All DBs
Position
5061090..5063939
Genome map
AA seq 949 aa AA seqDB search
MNAMRPQSDSAEPLRHDIRLLGRLLGTVIEECEGKRVFDTIETLRRTAVKFRREGNDADG
KLLEQRVKRLQGSDPNSVARAFSYFLHLANIAEDRDQNRRQRARAIADDTPARGSLREAV
QTLGRHGVGVARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQREGPLTPEE
LADLDASLLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRLYGDLSKLLNR
ESAKPFAAPPPPLEPFLRMGSWIGGDRDGNPNVDANTLERALLRQATVLFEHYLQEVHAL
GAELSVTTLLIGVDAQLLALADASGDDSPHRRDEPYRRALVGVYARLAATAQRLTGQDLA
RRSTVAAIPYERPEELSADLAVIAASLAAHHGSPIGKLRLAGLQQAVEVFGFHLATVDLR
QSSDVHERALAELFTCAGTQHDGKPLDYLALTEEQRVELLRAELAQARPLASPWIAYTED
TTRELAVLRAAAAGRARYGKQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQEIQPE
DGLMVVPLFETIPDLQRGADIMAAWLDLPEVRQRVKLAQNGAQEVMLGYSDSNKDGGFLT
SNWSLYQAERALVDVFSARNVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTE
QGEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAEATSAEDAHMAQHGPAMSFMSDTAQ
RTYRGLVYDTPRFADYFFAATPISEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCR
LMLTGWYGMGSAIEAYLETGAPDAPRSRRSRLAQLREMARDWPAFRTLLSNMEMVLAKSD
LAIAARYAQLVPQRGVRERIFGSISAEHGRTLAMLKLLTQRELLADNPTLQASLRERFAY
IDPLNYLQIDLIRRHRAAQKHPEAEVDKRVQRAIHLTINGIAAGLRNSG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatgcgcccgcagtccgattcagcagaacccttgcgtcacgatatccggctg
ttaggccggttactgggcaccgtcatcgaggaatgcgagggcaaacgcgtcttcgacacc
attgaaaccctgcgccgcacggcggtgaagttccgccgcgaaggcaatgacgcggacggc
aagttgctggagcagcgcgtcaagcgcctgcaaggcagcgatcccaactcggtcgcgcgc
gccttcagctacttcctgcacctggccaacatcgctgaagaccgcgatcagaaccgccgc
cagcgcgcgcgcgccatcgccgacgacacgcccgcacgcggcagcctgcgcgaagccgtg
cagacgctggggcgccacggagtgggcgtggcgcgcattcgccgcctgctggccgaggcc
tgcgtgatgccggtgctgaccgcgcaccccaccgaggtgcagcgcaagagcacgctggac
gtgcaccgcgaaatcgccgccgcgctgacgcagcgcgaaggccccctcacccccgaggaa
ctggccgacctggacgcttcgctgctcggccgcgtggccacgctgtggcagacccgcatg
ctgcgctacacgcggctcaccgtggccgacgaaatcgaaaacgcgctgtcgtactaccgc
agcacctttctgcaggtcattcctcggctgtacggcgacctgtccaagctgctgaaccgc
gaatccgccaagccgtttgccgcgccgcccccgccgcttgagccgttcctgcgcatgggc
agctggatcggcggcgaccgcgatggcaatcccaacgtggacgccaataccctggaacgc
gcgttgctgcgccaggccaccgtactgttcgaacactatctgcaagaagtgcacgcgctg
ggcgcggagctatcggtcaccaccttgctgatcggtgtcgacgcccaattgctggcgctg
gccgacgccagcggcgacgattctccccaccgccgcgacgaaccctaccgccgcgcgctg
gtcggcgtatacgcccgcctggccgccaccgcgcagcgcctgacgggccaggacctcgca
cgacgcagcaccgtcgccgccatcccctacgagcggcctgaagaactgtccgcggacctg
gccgtcatcgccgcatcattggccgcccaccacggctcgcccatcggcaagctgcgcctg
gccggcctgcagcaggccgtggaagtgttcggcttccatctagccacggtggacctgcgc
cagagctccgacgtgcacgagcgcgcactggccgaactgttcacctgcgcgggcacgcag
cacgacggcaagccgctggactatctggccctgaccgaggagcaacgcgtcgaactactg
cgcgccgagctggcgcaggcgcgcccgctggcctccccctggatcgcctataccgaagac
accacgcgcgaacttgccgtgctgcgcgcggctgcggccggacgggcccgctacggcaag
caggccgtgcgccagaccatcgtgtcgcataccgaaacgctgagcgacttgctggaagtg
atggtgctgcaaaaggaagccggcctcatcgcgccggccggacaggaaatccagcccgag
gatggcctgatggtcgtgccgctgttcgagaccatccccgacttgcaacgcggggccgac
atcatggccgcctggctggacctgcccgaagtccgccaacgcgtgaagctggcgcagaac
ggcgcgcaggaagtcatgctgggctattcggacagcaacaaggacggcggcttcctcacg
tccaattggtctctctaccaggccgagcgcgcgctggtcgacgtgttctccgcccgcaac
gtgcgcctgcgcctgttccacggccgcggcggctcggtcggccgcggcggcggttccagc
tttgacgccatcctggcgcaacccccgggtaccgtagccggccagatccgcctcaccgaa
caaggcgaagtcatccagagcaagtacaaggacgccgaggtcggccgctggcaccttgaa
ctcctggtcgccgccacgctggaatccagcctggcgccgcgcgccgaagccaccagcgcc
gaagacgcgcacatggcccagcacggtccggccatgtccttcatgtcggataccgcacag
cgcacctaccgcggcctggtctacgacaccccgcgcttcgccgactacttcttcgccgcc
acgcccatcagcgaaatcgccggcctgaatatcggctcgcgccccgcctcgcgcaaaaag
ggccagcgcatcgaagacctgcgcgccattccctggggcttttcctgggcgcaatgccgc
ctgatgctgaccggctggtacggcatgggctcggcgatcgaggcctatcttgaaaccggc
gccccggacgcgccgcgctcgcgccgcagccgcctcgcgcagctgcgcgaaatggcacgc
gactggcccgccttccgcacgctgctgtcgaacatggaaatggtgctggccaaatccgac
ctggcgatcgccgcgcgctatgcgcaactggtgccgcagcgcggcgtgcgcgaacgcatc
ttcggatccatcagcgccgagcacggccgcacgctggccatgctcaagctgctgacccag
cgcgaactgctggccgacaaccccacgctgcaggcgtcgctgcgcgagcgcttcgcctac
atcgatccgctcaactacctgcagatcgacctgatccgccgccaccgcgcggcacagaag
catcccgaggccgaggtcgacaagcgcgtgcagcgcgccatccacctgaccatcaacggg
attgcggcggggctgcgcaactcgggctga

DBGET integrated database retrieval system