KEGG   Achromobacter insolitus: BUW96_24110Help
Entry
BUW96_24110       CDS       T04671                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ais  Achromobacter insolitus
Pathway
ais00970  Aminoacyl-tRNA biosynthesis
ais01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ais00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BUW96_24110 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ais03029]
    BUW96_24110 (gatB)
Enzymes [BR:ais01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BUW96_24110 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BUW96_24110 (gatB)
Mitochondrial biogenesis [BR:ais03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BUW96_24110 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: APX78997
UniProt: A0A3S4SR51
LinkDB All DBs
Position
5260267..5261724
Genome map
AA seq 485 aa AA seqDB search
MNWEIVIGLETHTQLSTDSKIFSGSSTQFGAAPNTHANVVDLALPGSLPVMNRGAAERAI
RFGLAVGATIAPRSVFARKNYFYPDLPKGYQISQYELPVVVGGSLSFFVGEEEKTVNLTR
AHLEEDAGKSLHDDFSLANGAPGSGIDLNRAGTPLLEIVTEPEMRSAAEAVAYARALHSL
VVWLGICDGNMQEGSFRCDANVSVRPVGQKEFGTRTEIKNVNSFRFLERAITYEARRQIE
LIEDGGTVVQETRLYDADRDETRSMRSKEDAHDYRYFPDPDLPTLVISREWVDEVRAAMP
ELPAAQRARFESEYGLPAYDAAQLTVSRDLAAYFQAVANALPAGQAKLAANWVMGEVSAA
LNKDEKSIAESPVQAPALAALIGRIIDGTISNKIAREVFGAMWAGENGGQADAIIEARGL
KQISDTGAIGAMIDEVLAANPAIVEEYRAGKQKAFNSLVGQIMKAARGKANPQQVNDLLK
QKLDS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaaatcgtcatcggcctggaaacgcacacgcagctttccacggactccaag
attttttcgggtagcagcacccaattcggcgccgcgcccaacacccacgccaacgtggtc
gacctggcgctgccgggcagcctgccggtcatgaaccgcggcgcggccgaacgcgccatc
cgcttcggcctggccgtgggcgccaccatcgcgccgcgctcggttttcgcgcgcaagaac
tatttctatcccgacctgcccaagggctaccagatcagccagtacgagctgcctgtggtc
gtgggcggttcgctgtcgttcttcgtgggcgaggaagaaaaaaccgtcaacctgacgcgc
gcccacttggaagaagacgccggcaagtccctgcacgacgacttcagcctggccaacggc
gcccccggcagcggcatcgacctgaaccgcgcgggcacgcctctgctggaaatcgtgacg
gaaccggaaatgcgctcggccgccgaggccgtggcctacgcccgcgccctgcacagcctg
gtcgtgtggctgggcatttgcgacggcaacatgcaggaaggctcgttccgctgcgacgcc
aacgtgtccgtgcgccccgtgggccagaaggaattcggcacccgcaccgagatcaagaac
gtcaactcgttccgcttcctggagcgcgccatcacctatgaagcgcggcgccagatcgaa
ctgatcgaagacggcggcaccgtggtgcaggaaacccgcctgtacgatgccgaccgcgac
gaaacccgcagcatgcgcagcaaggaagacgcgcacgactaccgctacttccccgacccc
gacctgcccacgctggtcatctcgcgcgaatgggtggacgaagtccgggccgccatgccc
gaattgccggccgcccaacgcgcccgcttcgagtccgagtacggcctgcccgcctacgac
gcagcccagctcaccgtcagccgcgacctggccgcctacttccaggcggtggcgaacgcg
ctgcccgccggccaggccaagctggccgccaactgggtcatgggtgaggtctccgccgcc
ctgaacaaggacgaaaagagcatcgccgagtctccggtccaggcgccggcactggccgcc
ctgatcggccgcatcatcgacggcacgatctccaacaagatcgcccgcgaagtcttcggc
gccatgtgggccggtgagaacggcggccaagcggacgccatcatcgaggcgcgcggcctc
aagcagatcagcgacaccggcgccatcggcgccatgatcgacgaagtgctggccgccaat
cccgccatcgtggaagagtaccgggccggcaagcagaaggcgttcaactcgctggtgggc
cagatcatgaaggccgcgcgcggcaaggccaacccgcagcaggtgaacgatctattgaag
cagaagctggatagctga

DBGET integrated database retrieval system