KEGG   Achromobacter insolitus: BUW96_27260Help
Entry
BUW96_27260       CDS       T04671                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
ais  Achromobacter insolitus
Pathway
ais00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ais00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BUW96_27260
Enzymes [BR:ais01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BUW96_27260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC RbcS
Motif
Other DBs
NCBI-ProteinID: APX78162
LinkDB All DBs
Position
5914151..5915611
Genome map
AA seq 486 aa AA seqDB search
MDDLSQQTFLNHIGGAWVPCGTGKTAPNINPADTDDIVGRFQVSDAEDARQAVAAAEAAF
AGWRDTPISKRAAILFRAAQYLEDHASDIARELTREEGKSLNLAKDEVLRSAQTIRFYAV
EGQSYTGETYPNDDPDMVVYSQREPLGVVTVISPWNFPISIPARKIAPALITGNTVVFKP
SSDAPMSGYRLTEAFVQAGLPAGVLNFLTGPAGAVGEAITAARAVRAISFTGSTAAGEQI
HRTAGLTTRTQMELGGKNPLIVLADADLDRAVDLAVKGGFSLSGQACTGTSRVLVDKRVR
QAYTDKLLARIKTLTIGNGLDGNFDLGPLATAKQLDNVLGYVAVGKQEATHLYGGDRLTG
AGFERGYYVTPALFTDVSQQMRIAREEIFGPVIALIEVDGYEDAIAKANDTEYGLSAAIA
TTDARYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKHSSTSTFRESGRVGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggacgatctttcgcagcaaacgttcctgaaccacatcggcggcgcctgggtgccctgc
ggtaccggcaagacggcgcccaatatcaatcctgccgataccgacgacatcgtcggccgc
ttccaggtgtctgatgcggaagacgcccgccaggcggtggccgcggccgaggctgccttc
gcgggctggcgtgatacgccgatctccaagcgcgccgccattctgttccgcgcggcccag
tacctggaagaccatgccagcgacatcgcgcgcgaactgacgcgcgaagagggcaagagc
ctgaacctggccaaggacgaggtgttgcgctcggcgcagacgatccgcttctatgcggtg
gaggggcagtcctacacgggcgaaacctatcccaacgacgatcccgacatggtggtctac
agccagcgcgagccgctgggcgtggtgacggtgatctccccctggaactttccgatttcc
atccccgcgcgcaagatcgctccggcgctgatcaccggcaacacggtggtattcaagccg
tcttccgatgcgcccatgtcgggctaccgcctgaccgaggccttcgtgcaggcaggcctg
ccggccggggtgctgaacttcctgaccggtccggccggcgccgtcggcgaagccatcacg
gcggcacgggcggtgcgggcaatttcctttaccggctccactgccgccggcgaacagatc
caccgcaccgcggggctgaccacccgcacgcagatggagctggggggcaaaaatccgctg
atcgtgctggcggacgccgacctggaccgtgccgtggacctggccgtgaagggcggcttt
tcgctgagcggccaggcctgcaccggcacgagccgcgtactggtggacaaacgggtgcgc
caagcctacacggacaagctgctggcccgcatcaagacgctgaccatcggcaatggcctg
gacggcaacttcgacctgggcccgctggccacggccaagcaactggacaacgtgctgggt
tacgtggcggtcggcaagcaggaggccacccatctgtatggcggcgaccgcctgaccggc
gccgggttcgaacgcggctattacgtaacgccagcgctgttcaccgacgtctcccagcaa
atgcgcattgcccgcgaagaaatattcggtcccgtgatcgcgctgatcgaggtggacggc
tacgaggacgccattgccaaggccaacgacaccgagtacgggttgtcggcggccattgcg
accaccgacgcgcgctatgcgcaccgcttcgctcgggatatccaggccggcacagtgaag
ataaaccggaccaccaccggcaacctgatcaacgcgccgttcggcggcctcaagcattcc
agtacgtccacgtttcgcgaatcgggccgcgtggggctggagttctacacacagatcaaa
actgtctaccgcgccggctga

DBGET integrated database retrieval system