KEGG   Achromobacter insolitus: BUW96_29500
Entry
BUW96_29500       CDS       T04671                                 

Definition
(GenBank) hypothetical protein
  KO
K06867  uncharacterized protein
Organism
ais  Achromobacter insolitus
Brite
KEGG Orthology (KO) [BR:ais00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BUW96_29500
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank DUF4226
Other DBs
NCBI-ProteinID: APX78549
LinkDB
Position
6397967..6398638
AA seq 223 aa
MPIFRAGRIWLAAFLLSMGGAAGAASPDTSLLTAAGDGDVARVKQLLEQGAAIETRDAQG
NTPLLRATQGNHVEAARALIEAGANVNAQNAIHDSAYLLAGARGYREVLALTLAHGADLK
STNRYGGTALIPACERGHVEVVDMLLRAGVDPDHVNNLGWTGLLEAVILGDGGARHQAIV
KRLIEAGADVNLADGKGVTPLRHARERGQAEIARLLEAAGAKG
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcctatttttcgcgcaggccgcatctggctagccgcattcctgttgagcatgggaggc
gcggccggcgccgcgagcccggatacgtcgctgctgaccgccgcgggcgatggcgacgtt
gcccgcgtcaagcagctgttggaacagggcgccgccatagagactcgggatgcgcaaggc
aatacgccgttgctgcgcgccacccagggcaaccacgtcgaggcggcgcgcgccctgatc
gaggccggcgccaacgttaacgcgcagaacgctatccatgacagcgcctacctgctggcc
ggcgcccgaggctatcgcgaagtcctggcgctgacgctggcgcatggcgcagacctgaaa
agcaccaatcgctacggcggaaccgccctgattcccgcctgcgaacgcgggcacgtcgag
gtggtggacatgctgttgcgcgcgggcgtggatccggatcacgtgaacaacctcggctgg
accggcctgctcgaagccgtgatcctgggcgacggcggcgcgcgccaccaggcgatcgtc
aagcggctgatcgaagccggtgcggacgtcaacctggctgacggcaaaggggtgacgccg
ctgcggcatgcgcgcgagcgtggacaggccgagattgcgcgcctgctggaggcagcaggg
gcgaagggctga

DBGET integrated database retrieval system