KEGG   Amycolatopsis japonica: AJAP_02225Help
Entry
AJAP_02225        CDS       T03225                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aja  Amycolatopsis japonica
Pathway
aja00500  Starch and sucrose metabolism
aja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AJAP_02225
Enzymes [BR:aja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AJAP_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AIG73375
UniProt: A0A075UT39
LinkDB All DBs
Position
429346..431514
Genome map
AA seq 722 aa AA seqDB search
MRKLVLPALAGVVIAGLVPAVAEAQGGEAPGAPGAHPSWLPADKTGFGTARERASNVWFT
LQGGRMSEVYYPDLSTPGVRSLDLVVTDGTSFATVDSSAKAQQVRRTGGLTYEQTVTDDQ
RRWKLRKTYVTDPARASVLIDVDFVSLTGRPYQVYAVADPDLTNEGSDDSARSQGASAVS
SDAKTAAALAAEPAFSRTSVGFAGSSDGLTQLTKSFRLKDYATAAKGNVLITGQTSVDGV
RSRDFTLSLGMGAKDSDALANAKASLRRGFADAARAYDRGWKQYLRQVKDAPSSLKTKRE
RDLYQASVLMLAASEDKIHQGALIASPSMPWRFGNNDPEWSPSGTYHLVWPRDLYQIATG
LLAAGDRDAANRSVDYMFGTQQLPDGHLPQNSHVDGTPYWTSIQLDETALPIVLAQQLGR
TDAKTWRGVRKAAEFLLSYKADNGHASPYSQQERWEEQDGYSPSTIAAVIAGLVCAADLA
KANGADADAARYLAAADAFKAKLARWTVTTNGPLSKDPYFVRLTKDGDANNGTKYNLGNS
SVTMDQRAVTDAGFLELVRLGIYGADDPVIKNSIKVTDADIAFTTPTGQFWHRYTKDGYG
EKADGSPWDYTFPAESRTTFGRLWPLLAGERGEYDLAAGDRGTAAKRLRDLGRVSSSGDT
MPEQVWDENAPSGRPGFPAGTPTASATPLAWTHAQYLRLAWSVEAGKVIEQPRVVRCHFL
GC
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaactcgtgctcccggcactggcaggcgtggtgatcgcggggctggtcccggcg
gtcgccgaggcccagggaggtgaggcgccaggtgcgccaggcgcccatccgagctggcta
ccggccgacaagaccggcttcggcaccgcccgcgaacgggcgagcaacgtctggttcacc
ctgcagggcggccggatgtccgaggtctactacccggatctgtcgacgcccggcgtgcgg
tcgctggatctcgtcgtgaccgacgggacgagcttcgcgaccgtcgattcgtcggccaag
gcccagcaggttcgccgcaccggcggcctcacctacgaacagaccgtgaccgacgaccag
cgccgctggaagctccgcaagacctacgtcaccgacccggcgcgcgcgagtgtgctgatc
gacgtcgacttcgtttcgctgaccggccgcccgtaccaggtgtacgcggtcgcggatccc
gatctcaccaacgaaggatccgacgactccgcgcgttcacagggtgcgagcgcggtctcg
tcggatgcgaagactgcggccgcgttggcggcggaaccggcgttctcgcggacttccgtc
ggcttcgcgggctcctccgacggcctcacgcagttgacgaagtccttcaggctcaaggat
tacgcgaccgcggccaagggcaacgtgctgatcaccgggcagacctccgtcgacggtgtc
cgctcgcgtgacttcacgctttcgctgggtatgggcgcgaaggactccgacgcgctcgcc
aacgcgaaggcctcactgcggcgcggattcgccgacgccgcccgcgcgtacgaccgcggg
tggaagcagtacctccgtcaggtgaaggacgcgccgtcctccttgaagaccaagcgggag
cgcgatctctatcaggcgtcagtgctcatgctcgcggcgagcgaggacaagatccaccag
ggggcgctcatcgcgtcgccgagcatgccgtggcggttcgggaacaacgaccccgagtgg
tcgccgtcgggcacgtatcacctggtctggccgcgtgacctctaccagatcgcgaccggg
ctgctcgccgccggcgatcgcgacgccgcgaaccggtcggtcgactacatgttcggcacg
cagcagctgccggacgggcatctgccgcagaacagccacgtcgacggcacgccgtactgg
acgtccatccagctcgacgagaccgcgttgccgatcgtgctcgcgcagcaactcggccgc
accgacgcgaagacctggcgcggtgtgcgcaaggcggcggaattcctgttgtcctacaag
gcggacaacgggcacgcgtcgccgtacagccagcaggaacgctgggaggagcaggacggc
tactcgccttcgacgatcgccgcggtgatcgccgggctggtctgcgcggccgacctcgcc
aaggcgaacggtgccgacgccgacgcggcgcgctacctcgcggccgccgacgccttcaaa
gcgaaactcgcccggtggacggtgaccacgaacggcccgctgtcgaaggacccgtacttc
gtccggctgaccaaggacggcgacgcgaacaacggcacgaagtacaacctgggcaattcc
agcgtgaccatggaccagcgtgcggtgaccgacgccggattcctcgaactggtgaggctg
ggtatctacggcgccgatgacccggtgatcaagaacagcatcaaggtcaccgacgccgac
atcgcgttcaccaccccgacggggcagttctggcaccgctacacgaaggacggatacggc
gagaaggccgacggctcgccgtgggactacacgttcccggccgaaagccggaccaccttc
gggcgactgtggccgctgctcgcgggtgaacgcggcgagtacgacctcgccgccggtgac
cggggtacggccgcgaagcggcttcgcgatctcgggcgcgtcagcagctccggggacacg
atgccggagcaggtctgggacgagaacgcgccttcggggcgcccgggcttcccggcgggc
acgccgaccgcgtccgcgacgccgctggcctggacgcacgcccagtacctccggctcgcg
tggtcggtggaggccgggaaggtgatcgagcagccgcgggtcgtgcggtgccacttcctg
gggtgctga

DBGET integrated database retrieval system