KEGG   Amycolatopsis japonica: AJAP_05565Help
Entry
AJAP_05565        CDS       T03225                                 

Gene name
gabT1
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
aja  Amycolatopsis japonica
Pathway
aja00250  Alanine, aspartate and glutamate metabolism
aja00410  beta-Alanine metabolism
aja00640  Propanoate metabolism
aja00650  Butanoate metabolism
aja01100  Metabolic pathways
aja01120  Microbial metabolism in diverse environments
Module
aja_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AJAP_05565 (gabT1)
   00650 Butanoate metabolism
    AJAP_05565 (gabT1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AJAP_05565 (gabT1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AJAP_05565 (gabT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aja01007]
    AJAP_05565 (gabT1)
Enzymes [BR:aja01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AJAP_05565 (gabT1)
Amino acid related enzymes [BR:aja01007]
 Aminotransferase (transaminase)
  Class III
   AJAP_05565 (gabT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIG74033
UniProt: A0A075UMA4
LinkDB All DBs
Position
complement(1113675..1114925)
Genome map
AA seq 416 aa AA seqDB search
MAQLSPLLKQATPVVVDHGEGVYLYDTDGKRHLDFTAGIGVTSTGHCHPHVVSAAQEQIG
KLIHGQYTTVMHKPMLELTEKLGGVLPEGLDSLFYANSGSEAVEAALRLSRQATKRPNVI
VFQGGFHGRTVAAATMTTSGTRFSAGISPLMSGVHVAPFPYAFHYGWDEETATKFALREL
DYLFATVCAPNETAAFFIEPVLGEGGYVPANPAFLAGLRERADKHGILLVMDEIQTGFGR
TGRFWGHEHFGVRPDIVLIAKGLASGFPISGIAASEELMAKALPGSQGGTYGGNAVACAA
AIATLEVIQREGLVENAAERGRQLLEGVRVIADKSPSIGDVRGLGLLVGSEFTTPDGEPD
TAKAQAAQKAASSNGLLLLTCGAYMNVVRMVPPLIVDSEQVDEALRIWGDVVAGVE
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctatcaccgctgctcaagcaggcaacgccggtcgtggtcgaccacggtgaa
ggggtttacctctacgacaccgatggcaaacgtcacctggatttcaccgccggtatcggc
gtgaccagcaccggccactgccacccgcacgtggtgagcgcggcgcaggagcagatcggc
aaactcatccacgggcagtacacgacggtcatgcacaagccgatgctggagctgaccgag
aagctgggcggcgtcctgccggagggcctggattcactcttctacgcgaactcgggcagc
gaggcggtcgaagcggcgctccggctgtcgcggcaggcgaccaagcggcccaacgtcatc
gtcttccagggcgggttccacggccggacggtcgcggcggcgacgatgacgacgtcgggt
acccggttcagcgccgggatctcgccgctcatgtccggggtgcacgtcgcacccttcccg
tacgccttccactacggctgggacgaggagacggcgacgaagttcgccctgcgcgagctc
gactacctgttcgcgacggtctgcgcgccgaacgaaacggccgcgttcttcatcgagccg
gtgctcggcgagggcgggtacgtcccggcgaaccccgcgttcctcgccggactacgggag
cgcgccgacaagcacgggatcctgctggtgatggacgagatccagaccggtttcggccgg
acgggccggttctggggacacgagcacttcggggtacgcccggacatcgtgctcatcgcg
aaggggctcgcgagcggcttcccgatctcgggcatcgccgcgtcggaggagctgatggcg
aaggcgctccccggttcccagggcggcacttacggcggtaacgcggtggcctgcgccgcg
gcgatcgccacgctcgaagtgatccagcgcgaaggtctggtcgagaacgccgccgaacga
ggacgccagctcctggaaggtgtgcgggtgatcgcggacaagtcgccgtcgatcggtgac
gtgcgcgggctggggctgctggtcggttccgaattcaccacaccggacggcgagccggac
acggcgaaggctcaggcggcccagaaggcagcgtcctccaacgggttgctcctgctgacc
tgcggggcgtacatgaacgtcgtgcggatggtgccgccgctgatcgtcgactcggaacag
gtcgacgaggcgctgcggatctggggcgacgttgtggcgggggtcgagtga

DBGET integrated database retrieval system