KEGG   Amycolatopsis japonica: AJAP_12430Help
Entry
AJAP_12430        CDS       T03225                                 

Definition
(GenBank) beta-ketoacyl synthase
Organism
aja  Amycolatopsis japonica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 PS-DH KR Ketoacyl-synt_C Thioesterase KAsynt_C_assoc PP-binding adh_short Docking Epimerase Thiolase_N Polysacc_synt_2 GDP_Man_Dehyd Abhydrolase_1 Abhydrolase_3 DUF3530 NAD_binding_4 NmrA
Motif
Other DBs
NCBI-ProteinID: AIG75368
UniProt: A0A075UQV0
LinkDB All DBs
Position
2585173..2590944
Genome map
AA seq 1923 aa AA seqDB search
MKDTEDKLRYFLKQVTADLHETRKRLKETETAGTEPIAIVGMACRYPGGVASPEDLWRMV
ETGGDGISGFPVDRGWDLEALYDPDPDKQGTSYVSQGGFLHDVAEFDPAFFGISPREALA
MDPQQRLLLETSWEAIERAGIDPGSLKGSRTGVFAGLMYHDYVSGLTEIPDEVGGYLGTG
NSGSIASGRVSYTFGFEGPALTVDTACSSSLVTLHLAAQALRRGECDLALSGGVTVMFTP
GTFVEFSRQRGMAPDGRCKPFAEEADGTGWSEGVGMLLVERLSDARRNGHPVLAVLRGSA
VNQDGASNGLTAPNGPSQQRVIREALADARLTTADVDVVEAHGTGTTLGDPIEAQALLAT
YGKGRPSDRPLWLGSIKSNLGHTQAAAGVAGIIKMVQALRSGTLPRSLHAETPSSHVDWS
AGAVSLLDEARPWPELDRPRRAAVSSFGISGTNAHVVLEAAPAAEESEARQPVVTGATPW
LLSARTPEALRARAAQLRSFVDLPGAAATLAARPLFGHRAAIVGDPRAALDALAAGEPSS
LLIEGIAQSGKAVFVFPGQGSQWVGMAEELLLAAPVFAESMAECEKALSSFVDWKLSEVL
SDAAALERVDVVQPVLFAVMVSLARLWRACGVEPAAVVGHSQGEIAAACVAGALSLDDAA
RVVCLRSKAILALSGLGGMVSVAASEDRVRELLPEGVSVAAVNGPSAVVVSGDVAGLDAL
VKRCELLDVRAKRIPVDYASHSAHVDAIEQDVVSALAGISPQAPVIPFYSTVTDEPLELD
AGYWFRNLRGTVQFAATVDRLLEDGFRFFVETSPHPVLVPGISEEAVALGSLRRGEGGAE
RFAASLAEAHVHGLSPAWSSILPTADWVDLPTYPFQRKRFWLEAGTAAGDASAFGQTVVD
HPLLGAVVAVPGTGGLLYTGRISLETHPWLADHAVSGTVLVPGTAFVELTLAAGVQVDCT
MLDELTLEAPLVLEEGTDVRLSVELGDADVDGRREVGVYSRRGDEPWTRHANGVLLPETD
GVPTPLAEWPPAGAERVGVEALYDELADAGLEYGPAFQGLRAAWRRENDVFAEIDLPEAQ
TGDAPAFGLHPALLDGALHGIALGVLPDDAEGLRLPFAFSGVRLWSRGATALRVRLRPAA
DGVALTVADAEGLPVADVDGLLLRPVSVSGLGGYRESLFGLDWVPAGATEPHDATVWHCE
SGDLRTVLGAALERVRTWLDEPGDGPLVVATRGGIATERPDPVAAAVWGLVRSAQSEHPG
RFVLVDGDVPAALPAGESQVVVRDGVSFVPRLVRVPEPGPARAWSDGDVVLITGGTGLLG
AAVAKHLVVTHGVRSLVLLSRSGAAAPGAAALADELTGLGAEVRILACDAADREALRQVL
AAHPVTGVVHAAGVLDDGLITAQTPERLDRVLAPKVDAAVNLHELLPDAAPFVMFSSAAG
VFGNPGQSGYAAANAFVDALVERRRADGAAAASLAWGLWATTSAMTDSADVERMARAGLG
GLSTEEGLELFDAALATGRTLTVPMLLDLTALRAEEIPPLLSGLVRTRARRAPDGGGAFR
ARLAGLDADGRDTEILELVRGQVAAVLGHDGAGAIDADVAFLELGFDSLTAVDLRNRLAA
STGLRLPPSLVFDHPTPLAVAERISGDFSASDRQPETLPAATGFFGAMFARAVELGEVAQ
FVALAAQASRYRPSFTVETAREQNLQPVRLAKGPSGPELVCVPSLLVGSGAHEYARFAAS
FRDVQDVSVVPVPGFGHGQPLPDSVEAVLHAQAEAILREGGDPVVLVAHSSGGPLAHALA
RHLEEAGAAPRALVLIDVYPQDEHALDGIRDRLADGLGDDTRLTAMGAYLRLFADHVPAP
TDVPTLLVRASEPLEAWRDRAGWQSGWALPHDTVDVEGDHFTMLERHAGTTADAVREWLG
RLP
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaccgaggacaaactccggtacttcctcaagcaggtcaccgcggatcttcac
gaaacccggaaacgcttgaaggagaccgaaaccgcgggcaccgaaccgatcgccatcgtc
gggatggcctgccgctatcccggcggggtcgcctcgcccgaggatctgtggcggatggtc
gaaaccggcggcgacgggatcagcggattcccggtcgaccgcggctgggacctcgaagcg
ttgtacgacccggacccggacaagcaggggacgagttacgtttcgcagggcggtttcctc
cacgacgtcgccgagttcgacccggcgttcttcgggatctcgccacgcgaggcgctggcg
atggatccgcagcagcggctcctgctggagacgtcgtgggaggccatcgagcgggcggga
atcgatccgggttcgctcaagggcagccggaccggggtgttcgccgggctgatgtaccac
gactacgtctccgggctgaccgagattcccgacgaggtcggcggctacctcggcaccggg
aactccggcagcatcgcctccgggcgggtgtcgtacaccttcgggttcgaggggccggcg
ctcaccgtggacaccgcgtgctcgtcgtcgctggtgaccctgcacctcgccgcacaggcg
ttgcggcggggcgagtgcgacctcgcgctgtccggcggcgtgacggtgatgttcaccccc
gggacgttcgtggagttcagccgtcagcgcggaatggcgccggacggccgctgcaaaccg
ttcgccgaagaggcggacggcaccggctggtccgagggcgtcggcatgctgctggtggaa
cggctttccgacgcgcggcgcaacggccatccggtactggcggtcctgcgcgggtcggcg
gtgaaccaggacggcgcgtcgaacggcctgaccgccccgaacggcccgtcccagcagcgg
gtgatccgcgaggcgctcgccgacgcccggctgacgacggcggacgtcgacgtcgtcgag
gcgcacggaaccggcaccacgctgggcgacccgatcgaggcgcaggcgctgctcgcgacc
tacggcaagggcaggccgtcggatcggccgctgtggctcgggtcgatcaagtcgaacctc
gggcacacgcaggccgccgccggggtcgccgggatcatcaagatggtgcaggcactgcga
agcgggaccctgccgcgaagcctgcacgcggagaccccgtcgtcgcatgtggactggagc
gcgggcgcggtctcgttgctggacgaagcgcggccgtggccggaactcgaccgccctcgc
cgggccgcggtgtcgtcgttcggtatcagcggtaccaacgcgcacgtcgtcctcgaagcc
gccccggccgctgaggaaagtgaggctcggcagccggtggtgaccggtgcgacgccgtgg
cttctgtcggcgcggacgccggaggcgttgcgggcgcgagctgctcagcttcggtccttt
gtggatcttcctggtgccgccgccacgctggccgcgcggccgctgttcgggcaccgggcg
gccatcgtcggtgatccgcgcgccgcgctcgacgcgctcgccgccggagaaccgtcgagc
ctgctgatcgagggcatcgcgcagtcgggtaaggctgtcttcgtgttcccgggtcagggt
tcgcagtgggtggggatggcggaggagttgttgctggctgctccggtgttcgcggagtcg
atggctgagtgcgaaaaggctttgtcgtcctttgtggactggaagctgtccgaggtgttg
tcggatgcggctgcgttggagcgggttgatgtggtgcagcctgttttgttcgcggtgatg
gtgtcgttggcgcggctgtggcgggcgtgtggtgtggagcctgcggcggtggtgggtcat
tcgcagggtgagatcgcggctgcgtgtgtggctggtgcgttgtcgttggatgatgctgct
cgggttgtgtgtttgcggagtaaggcgattctggcgttgtcggggctcggtggcatggtg
tcggtggctgcctcggaggaccgggtgcgtgagttgctgcctgagggtgtgtcggtggcg
gcggtgaacgggccgtctgcggtcgtggtgtccggtgatgtcgcgggcttggacgcgttg
gtcaagcgatgtgagctgctggacgtacgcgcgaagcggatccctgtggattacgcgtcg
cattcggcgcatgtggatgcgatcgagcaggacgtggtgtctgcgttggcgggtatttcg
ccgcaggcgccggtgattccgttctattcgacggtgaccgatgagcctctggaattggat
gctgggtattggttccggaatctgcgggggacggtgcagttcgcggcgacggtggatcgg
ttgctggaggatggtttccggttcttcgtggagacgagcccacatccggtgctggttcct
ggcatcagcgaagaggccgtcgcgttgggaagtttgcgccggggcgagggtggtgcggag
cggttcgccgcgtcgctcgccgaagctcacgtgcacggcctgagcccggcgtggtcttcg
atcctgccgacggcggactgggtcgacctgccgacgtatccgttccagcgcaagcggttc
tggctggaagccgggaccgccgccggggacgcgtcggcgttcgggcagacggtggtggac
cacccgctgctcggcgccgtcgtcgcggtccccgggaccggcgggctgctgtacaccggc
cggatctcgctggaaacgcatccctggctcgccgatcacgccgtgtccgggaccgtgctc
gtacctggcaccgcgttcgtggagctcacgctggccgccggcgtccaggtggattgcacg
atgctcgacgaactgaccctcgaagccccgctcgtgctcgaagaaggcaccgacgtccgg
ctctcggtcgaactcggcgacgcggacgtcgacggccgtcgcgaggtcggcgtgtactcc
cgccgcggcgacgaaccctggacccggcacgccaacggcgtcctgttgcccgaaacggac
ggcgtgcccacgccgctcgcggaatggccgcccgccggggcggaacgcgtcggcgtcgag
gcgctgtacgacgagctcgcggacgcgggcctcgaatacggcccggcgttccaaggactt
cgcgccgcttggcgtcgcgagaacgacgtcttcgccgaaatcgacctgcccgaagcccag
accggcgatgctccggccttcggcctgcatcccgcgttgctggacggcgcactccacggg
atcgcgctgggagtgcttcccgacgatgccgaggggcttcggctcccgttcgcgttctcc
ggggtccggctgtggtcgcggggtgcgacggcattgcgggtgcggctgcggccggcggcg
gacggggtcgcgctgaccgtcgccgacgctgaaggcctgccggtcgccgacgtggacggt
ctgctgctgcggccggtgtcggtgtccggcctcggtggatatcgagagtccctgttcggc
ctggactgggtgcccgcgggcgcgaccgaaccgcacgacgcgacggtgtggcactgcgaa
tccggggatctccgcaccgtgctgggtgcggcactcgaacgcgtccggacgtggctcgac
gaaccgggggacggcccgctcgtggtggccacgcgaggtgggatcgcgaccgaacgcccg
gatccggtggcggccgcggtgtgggggctcgtgcgttcggcgcagtcggagcaccccggg
cggttcgtgctcgtggacggcgacgtcccggccgcgctgcccgccggggaatctcaggtc
gtggttcgcgacggggtcagcttcgtcccaaggcttgtccgggttccggaacccggaccg
gcgcgggcgtggagcgacggcgacgtcgtgctgatcaccggcggcaccggcctcctcggc
gcggccgtcgcgaaacacctggtggtgacgcacggcgtccgttcgctggtgctgctgagc
cgttccggcgcggccgcgcccggtgcggcggcgctggcggacgaactcaccgggctgggt
gccgaggtccggatcctggcgtgcgacgcggccgaccgggaggcgttgcgccaggtgctg
gccgcgcatccggtgaccggtgtcgtgcacgccgccggtgtcctcgacgacgggctgatc
accgcgcagacccccgaacggctcgaccgggtgctcgcgccgaaggtggacgccgcggtg
aacctgcacgaactcctgcccgacgccgcgccgttcgtgatgttctcctcggcggccggt
gtcttcggcaatccggggcagtccggttacgccgcggccaacgcgttcgtggacgcgctg
gtggaacgccgccgggcggacggcgccgccgcggcgtcactggcgtggggcctgtgggcg
accaccagtgccatgaccgattccgccgacgtcgagcggatggcgagggccgggctcggc
ggactgtccacagaggagggtctggagctgttcgacgccgcgctcgccaccgggcggacg
ctgaccgtcccgatgctgctcgacctcaccgctctccgcgccgaggagatcccgccgttg
ctgagcggactcgtccgcacccgtgcccggcgcgcgcccgacggcggcggcgcgttccgc
gcacggctcgccggactcgacgcggacggccgtgacacggagatcctggaactggttcgc
ggccaggtcgcggccgtcctcgggcacgacggggccggcgccatcgacgccgacgtcgcc
ttcctcgaactcggcttcgactcgctcaccgccgtcgacctgcgcaaccggctggcggcc
tcgaccggcctgcggctcccgccgtcgctggtcttcgaccacccgacgccgctcgccgtc
gcggaacggatctccggtgacttctcggcctccgaccggcaacccgagacactgcccgcg
gccacgggcttcttcggcgcgatgttcgcccgcgctgtcgaactcggcgaggtcgcgcag
ttcgtcgcgctggccgcgcaggcgtcgcgctaccggccgtcgttcaccgtcgaaaccgcg
cgggaacagaacctgcaaccggtccgcctcgcgaaaggcccgtccggtcccgaactcgtc
tgcgtcccctccctcctggtcggctcgggcgcgcacgaatacgcgcggttcgcggcgtcg
ttccgggacgtgcaggacgtttccgtcgttccggtgcccggtttcgggcacgggcagccg
ctgccggactcggtcgaggcggtcctccacgcacaggcggaggccatcctccgcgaaggc
ggcgacccggtggtcctggtggcccactcgtcgggcggcccgctcgcccacgcgctggcg
aggcacctggaggaagcgggcgccgcgccccgcgcgctcgtgctgatcgacgtctacccg
caggacgaacacgcgctggacggcatccgcgaccggctcgccgacggcctcggggacgac
acgcggctcaccgcgatgggtgcttacctgcgcctgttcgccgaccacgtgcccgcaccg
accgacgtgccgaccttgctggtgcgggcgtcggagccgctggaagcgtggcgcgaccgg
gccggatggcagtccggctgggccctgccgcatgacacggtggacgtcgagggggatcac
ttcacgatgctggagcggcatgccggtacgaccgctgacgccgttcgggagtggctgggg
cggctgccttaa

DBGET integrated database retrieval system