KEGG   Amycolatopsis japonica: AJAP_35390Help
Entry
AJAP_35390        CDS       T03225                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
aja  Amycolatopsis japonica
Pathway
aja00020  Citrate cycle (TCA cycle)
aja00480  Glutathione metabolism
aja01100  Metabolic pathways
aja01110  Biosynthesis of secondary metabolites
aja01120  Microbial metabolism in diverse environments
aja01130  Biosynthesis of antibiotics
aja01200  Carbon metabolism
aja01210  2-Oxocarboxylic acid metabolism
aja01230  Biosynthesis of amino acids
Module
aja_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aja_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:aja00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AJAP_35390 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AJAP_35390 (icd)
Enzymes [BR:aja01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AJAP_35390 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIG79885
UniProt: A0A075VAJ5
LinkDB All DBs
Position
complement(7580390..7581613)
Genome map
AA seq 407 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDRLIHPYLDVNLEYYDLGIEERDRTDDQITVDS
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVIQNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGPGTLTMTYTPADGSEPMEFQVAQYPEGGGVAM
GMFNFRKSIEDFARASLQYGLDREYPVYMSTKNTILKAYDGMFKDVFEEIYQAEFKADFD
AKGISYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDSNPELIGFANKLE
QVVIETVESGKMTKDLALLISKDQPFQTTEEFLATLDANLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccagggcaccgtcgtcgagctcgacggtgatgagatgacccgc
atcatttggcagttcatcaaggacaggctgatccacccgtacctggacgtgaacctggag
tactacgacctgggcatcgaggagcgggaccgcaccgacgaccagatcaccgtcgactcc
gccaacgcgatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgccggacgag
gcgcgcgtcgaagagttcggcctgaagaagatgtggctctcgcccaacgggacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatccagaacatcccgcgcctg
gtaccgggctggaccaagccgatcatcatcggccgtcacgcgcacggtgaccagtacaag
gcgaccaacttcaaggtccccggcccgggcacgctgaccatgacctacaccccggccgac
ggttccgagccgatggagttccaggtcgcgcagtaccccgagggcggcggcgtcgccatg
gggatgttcaacttccgcaagtccatcgaggacttcgcgcgcgcctcgctgcagtacggc
ctcgaccgcgagtacccggtctacatgtcgaccaagaacaccatcctgaaggcctacgac
ggcatgttcaaggacgtgttcgaggagatctaccaggccgagttcaaggccgacttcgac
gccaagggcatctcctacgagcaccgcctgatcgacgacatggtcgccgcggcgatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacacg
gtcgcgcagggcttcggctcgctgggcctgatgacctcggtgctgcgcaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcacggtgacccggcactaccgccagcaccag
cagggcaagccgacctcgacgaacccgatcgcgtccatcttcgcgtggacccgtggcctc
gagcaccgcggcaagctggactcgaacccggaactgatcggcttcgcgaacaagctggag
caggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgcgctgctgatc
agcaaggaccagccgttccagaccaccgaggagttcctcgcgacgctggacgccaacctg
gccaagaagatcgcccagggctga

DBGET integrated database retrieval system