KEGG   Amycolatopsis japonica: AJAP_39845Help
Entry
AJAP_39845        CDS       T03225                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aja  Amycolatopsis japonica
Pathway
aja00250  Alanine, aspartate and glutamate metabolism
aja00410  beta-Alanine metabolism
aja00430  Taurine and hypotaurine metabolism
aja00650  Butanoate metabolism
aja01100  Metabolic pathways
aja01110  Biosynthesis of secondary metabolites
aja01120  Microbial metabolism in diverse environments
aja02024  Quorum sensing
Module
aja_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AJAP_39845
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AJAP_39845
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AJAP_39845
   00430 Taurine and hypotaurine metabolism
    AJAP_39845
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AJAP_39845
Enzymes [BR:aja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AJAP_39845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIG80748
UniProt: A0A075V5W6
LinkDB All DBs
Position
complement(8456562..8457935)
Genome map
AA seq 457 aa AA seqDB search
MVLHKGTASDPDRKTGANPLYAGAYPALAANIRLPHDSLAEDPLPPDTALQLVRDELMLD
GNARLNLATFVTTWMEPQARELMAECVDKNMIDKDEYPQTAELERRCVNILADLWHAPDP
TAIMGCSTTGSSEACMLAGMALKRRWSKLGRTGKPNLVMGANVQVCWEKFCEYWEVEPRL
VPMDGDRFHLTADEAIARCDENTIGVVAILGSTFDGSYEPVAEIAAALDGLAERSGWDIP
VHVDGASGAMIAPFLDPELSWDFRLPRVASINTSGHKYGLVYPGVGWVLWRDKDALPEEL
VFNVNYLGGDMPTFALNFSRPGAEVAAQYYTFVRLGREGFRAVQQASRDVATQLADGIAE
LGPFRLLTRGDQLPVFAFTTKPDVEGFDVFDVSRRLRERGWLVPAYTFPENRTDLAVLRI
VVRNGFTHDLAELLLADLRRLLPELDHGPRRRTAFHH
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgcacaaggggaccgcgtccgatccggaccgcaagaccggggccaacccgctg
tacgccggcgcgtatcccgcgctcgccgcgaacatccgtctcccgcacgacagcctcgcc
gaagacccgctcccgcccgacaccgcgctccagctggtgcgcgacgagctgatgctcgac
ggcaacgcccggctcaatctcgccacgttcgtcaccacgtggatggagccgcaggcccgc
gagctgatggccgaatgcgtcgacaagaacatgatcgacaaggacgagtacccgcagacc
gcggaactcgagcggcgctgcgtgaacatcctcgccgatctgtggcacgcgcccgatccc
accgcgatcatgggctgctccaccaccggctcgtcggaagcctgcatgctcgccggcatg
gcgttgaaacgccgctggtcgaagctgggccgcaccgggaagccgaatctggtgatgggc
gcgaacgtccaggtctgctgggagaagttctgcgagtactgggaggtcgagccgcggctg
gtgccgatggacggcgaccgcttccacctcaccgccgacgaggcgatcgcccgctgcgac
gagaacacgatcggcgtcgtcgcgatcctcgggtccactttcgacggcagctacgagccg
gtcgccgagatcgccgccgcgctcgacggcctggcggaacgctccggctgggacatcccc
gtgcacgtcgacggcgcttcgggcgcgatgatcgcgcccttcctcgatcctgagctgagc
tgggacttccgcctgccgagggtcgcgtcgatcaacacctccgggcacaagtacgggctc
gtctaccccggcgtcggctgggtgctgtggcgtgacaaggacgcgttgccggaggagctc
gtcttcaacgtcaactacctcggtggcgacatgccgactttcgcgctgaacttctcccgt
cccggcgccgaggtggccgcgcagtactacacgttcgtccggctcggccgcgaaggtttc
cgtgcggtgcaacaggcttcgcgtgacgtcgcgacccagctggcggacgggatcgccgag
ctgggcccgttccggctgctgacccgcggcgatcagctgcccgtgttcgccttcacgacg
aagccggacgtcgagggtttcgacgtcttcgacgtgtcacggcggcttcgcgagcgtggc
tggctcgtcccggcgtacacgttcccggagaaccggaccgacctcgcggtgctgaggatc
gtggtgcgcaacggtttcacccacgacctcgccgagctgctgctcgccgatctccgccgt
ctgctgcccgagctcgatcacggcccgcgacggcggaccgcgttccatcactga

DBGET integrated database retrieval system