KEGG   Histoplasma capsulatum: HCAG_01100Help
Entry
HCAG_01100        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K17862  linoleate 10R-lipoxygenase [EC:1.13.11.62]
Organism
aje  Histoplasma capsulatum
Pathway
aje00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    HCAG_01100
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.62  linoleate 10R-lipoxygenase
     HCAG_01100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase TPR_12 TPR_10
Motif
Other DBs
NCBI-GeneID: 5450207
NCBI-ProteinID: XP_001544054
UniProt: A6QUP4
LinkDB All DBs
AA seq 1324 aa AA seqDB search
MQFLHISSLAEYPTAQIIMWHPLSKLELCMDRAPRSLDPDVKTENNKLLRTPKNGHVNGK
LKDAPLPVAKRSKGRRVERQEIEDTFAKYSEFSGDHSRMKKDGSSGKFQEVRWMGWKGVR
TLLEVVKSKTSGKLVDDRDYLMERIIQLVANLPPESSAREQLTKTFVKSLWVSLPHPPLA
YLGDEYRYRAADGSNNNPMFPRLGAANTPYARSVRPITIQPAALPDPGLIFDSLFARQEF
KPHPTGVSSTDPRNQHISQTSSYLDLSTLYGDNQDDQNQMRTFKDGKLKADTFSDPRLLA
LPPACSVILVLLNRFHNYVVEQLAQINENGRFTKPHANLPPDQSAKAWVKYDNDLFQTGR
LITCGLYINITLYDYVRTIINLTRSNTTWSLDPRIDTKKVAAPESAESGVGNQVSFEFNL
AYRWHSCIGQLDEKWINDIYHDLFGKSGEDISMPELMVGMGKWKQKLPEDPSKRTFAKLK
RQADGRFRDEDLARIITEATEEVAGTFGPRNVPKALRAVEILGIQQARKFGCGTLNEFRK
FFGLKQYESFEEINSDPEIAGQLRNLYEHPDYVELYPGIVSEEPKIPMVPGAGICPTYTI
SRAVLSDAVALVRGDRFYTSDYNAKSLTNWGYTETHYDLSINQGVPDSIYAHYPMTIPSV
NKEIFAKLGRQSHFSWDRPALLSPRIDLTSYNGAKTILQNSKDFRVTWEASLGSHLASQG
FNESQAKVIDETFAQDSWREEVKQFYQDITQKLLKRNSVKIAGINQIDITRDLGNLTHVH
FAASTFNLPIKTKDNSKGVFTDHEMFMVMLAAFTSVFSDVDPTKSFPLRQVAREVGEQFG
QVVESYVKSIKAFNPFSSIIDRFQKDGNTLAKFGADATRRLLKAGLSVPQVALSYILPII
CTAVPSQAQAFTQIIDYYLSDEGKIHLPDINSLAKEDSLESDTKLLHYCMEGLRLNGPFS
SYRDSNANILINDGGREVSINDGDTVFISSARDPNIFPRPDEVVLDRPLESYIHYTDGAF
TCFGRDAQMVALSSMLRVVGRLDNLRPAPGPQGQLARISRPDGHFAYMREDWGGYSALPM
TLKVHYDATEAQPIKIITNYLAVWLLSEQIMLTPSYDFIELLYCCTWYLFERGRFDISFS
IAEKAVEFAKRSLKIKEQAVADNALDKHHPQLANSYINIGVFIAGMNPRDAIRLHEKAIV
IREGSPKYADDQMQLLSLNYMNIGRCWWMVKGLDKATAAYEKSISIIKELEEATGAPFAQ
KSWAMSALANVLIDKGKFDAAFDLFTQSVKVHQQVLGATHHKTVACYNKIAWFLRKQGEY
GMAM
NT seq 3975 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcttgcacatttcatcgctggccgagtacccgacagctcaaattattatgtgg
caccctctgagcaagctggagctctgcatggatcgggcgccgcggagccttgatccggac
gtcaagacagaaaataacaagcttctgcgaacaccgaagaatgggcatgtgaatggtaaa
ctgaaggatgcacccctacccgtcgcgaaacgcagcaaagggcgccgcgtcgaacgacag
gaaattgaggatacatttgcaaagtattcggaattcagcggcgaccattcccgcatgaag
aaagatggatccagcggcaaatttcaagaagtgaggtggatgggctggaagggcgtccgg
accctgttggaggtggtaaagagcaaaacttctggcaaacttgtcgacgatagggactac
ctcatggagcgaattattcaacttgtggccaatctccctccagaatcatcagcgcgagaa
cagctcaccaagacttttgttaaatcactctgggtctctcttcctcatccacccctcgca
tatctcggcgacgagtatcgctacagagccgccgatggatcgaacaacaacccaatgttt
ccccgactgggagctgccaacacaccctacgcgcgctccgtcagacctatcactatccag
cctgcggcacttccagacccgggtttgatcttcgatagtcttttcgctcgccaggaattt
aagcctcaccccactggagtctctagcaccgatccaaggaatcagcacatctcacaaact
tcttcgtatcttgatctttccacgctctatggtgataatcaagatgaccaaaaccaaatg
cgtaccttcaaggatgggaaactcaaagccgatacattttcggatcctagacttctcgca
ctcccacctgcttgcagcgttattttggtcctgctgaaccgattccacaactatgttgtc
gaacagctagcacagataaacgagaatggccggttcactaaaccccatgctaacctgcca
ccagatcaatcggcaaaggcatgggttaaatatgataatgacttgttccagaccgggcgg
cttataacatgtggcctctatataaatatcacattgtacgattatgtacgaaccataatc
aaccttacacggagcaacacgacctggagtttggacccaagaattgacacgaagaaagtt
gctgctccggaatctgcggaaagcggcgttggtaaccaggtatctttcgagttcaacctt
gcttatcggtggcattcatgtatcggccaacttgatgagaaatggatcaacgatatctac
cacgatctttttggcaaaagcggggaagatatttctatgccagagctgatggttggaatg
ggaaaatggaaacaaaaacttcctgaagacccttctaagaggacatttgccaagctaaag
cggcaagcagatggacggtttagggatgaagatctggctagaattataaccgaagcgact
gaggaagttgcaggaacattcggtccacgtaacgttcccaaggccctccgagcagtcgaa
atacttggaattcagcaggcgcggaaattcggctgtggcactttgaatgagttccggaag
ttcttcggcttaaagcagtatgaatcatttgaggaaatcaactctgaccctgaaatagcc
ggccagcttcggaatttatacgagcaccctgattatgttgagctttacccaggcattgtt
tcagaggagccgaagattcctatggtccctggagccgggatttgtccaacctatactatc
tcgagagcagttctttcagacgcagtagcacttgtgcgtggtgaccgattctacaccagc
gactacaatgccaaaagtttgacaaactggggatatacagagactcactatgatcttagc
atcaaccagggggtcccagactccatctacgcacactatcccatgacgattcccagcgta
aacaaggaaatttttgccaagctgggccgacagagtcatttttcttgggatcgccctgcg
ttgttgtcccctcgaattgacctcacttcctacaatggagcaaaaacaattcttcagaac
tctaaagatttccgagtcacttgggaggcgtccctcggttcacatcttgcaagtcagggc
ttcaatgagtcacaagctaaagtcatagatgaaacctttgctcaagactcgtggcgtgag
gaagtcaagcaattctatcaggatatcactcaaaaattgctgaagcggaactcagtgaaa
attgctggaattaaccagattgatatcacccgggatctcggtaatctcacgcatgtgcac
ttcgctgcaagtacttttaatcttcctatcaaaacaaaggataactcaaagggagtattc
accgaccatgaaatgttcatggtaatgctggcggcattcaccagtgtattctctgatgta
gaccccacaaaatctttccccctgcgacaggtggctcgtgaagtgggtgaacagtttggt
caggttgtggagtcatatgtcaaatctatcaaagcgtttaatccgttctctagtattatt
gataggttccagaaggatggcaacacattggccaagttcggcgcggacgcaacccgcagg
cttctaaaagccggcctcagcgttccacaggtggctttgtcgtatattcttcccattatc
tgtacagcagttccaagtcaagcccaggcttttactcaaatcatcgactattacttgtca
gatgagggcaaaatacacctccctgatatcaacagccttgcaaaggaggattccttagaa
tccgacacgaaacttctgcattattgtatggaggggcttcgacttaacgggccattcagt
tcctatcgcgattcaaatgcaaacattctcatcaatgatggtggtcgtgaagtttccatc
aacgatggagatacagtcttcatttcttctgctagggaccccaacatattcccaaggcct
gacgaagtcgttcttgacagacctctggaatcctatatccattacactgatggcgctttt
acctgtttcggaagagacgcacagatggtggcgctatcctccatgctgcgtgtagttggg
cgtctagataacctacgccctgcgccgggccctcaaggccaactggcgagaattagccgt
cctgacggacatttcgcttatatgcgagaagactggggtggctactcggcgctcccgatg
actctgaaagttcactacgacgctactgaggctcagccaatcaaaatcatcacaaattat
ctcgccgtctggctgttatcagagcaaatcatgctgacgccatcttatgattttattgaa
ctactttactgctgtacatggtatctttttgagaggggtcggttcgatattagcttctct
attgcggagaaggcagtcgaatttgccaagcggtcgttaaagatcaaagagcaggcagtt
gccgacaatgcgcttgacaaacatcaccctcaattagctaactcttacataaacatcggc
gtctttatcgcgggtatgaatccgcgcgatgcaattcgcttacatgaaaaggccattgtt
attcgggagggatcacctaagtatgcagatgatcagatgcaactgttatctttgaattac
atgaacatcggtcgatgctggtggatggtaaagggacttgacaaagctactgccgcatat
gagaaaagtatttctatcatcaaagagctagaagaggcaacgggagcaccttttgcacag
aaatcttgggctatgtcggcccttgcgaacgtactcattgacaaggggaagtttgatgcc
gcctttgatcttttcacccagagtgtgaaagtgcatcaacaggttcttggggcaactcac
cacaagaccgtagcctgttacaacaaaatcgcctggtttctgcgcaaacaaggggagtat
ggaatggcaatgtaa

DBGET integrated database retrieval system