KEGG   Histoplasma capsulatum: HCAG_01368Help
Entry
HCAG_01368        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aje  Histoplasma capsulatum
Pathway
aje00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HCAG_01368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aje02000]
    HCAG_01368
Enzymes [BR:aje01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HCAG_01368
Transporters [BR:aje02000]
 Other Transporters
  Pores ion channels [TC:1]
   HCAG_01368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N GST_C GST_C_5
Motif
Other DBs
NCBI-GeneID: 5450833
NCBI-ProteinID: XP_001544321
UniProt: A6QVG1
LinkDB All DBs
AA seq 230 aa AA seqDB search
MPQVVRHPVATVQRTWITLEEKKILYQYIETNPYDKSPSLLALNPKGLVPTIGAPLPNNQ
GTKPLYESNIINEYLEEAYPDHTPHLLPKGPFERARARIWIDFVGSRITPNYRKIQYAKS
TEERDAARAEFLKAVKEFTREMDPEGPYFLGEEIGLPDIALAPWVARFFMVEKFKEGGTG
IPAEGEGGKDEGVWRRWRKWEAAIKGRESFKNTFSERVYYENIATQEWAR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaggtcgttcgacatcccgttgcaactgttcaacgcacatggatcactctcgaa
gagaaaaagattctctaccaatacatcgaaacaaacccatacgacaagtctccctccctt
ctcgctttaaaccccaagggcctcgtgcccactattggcgcccccctgcccaataatcag
ggcacaaaacccctctacgaatccaacatcatcaatgaatacctcgaagaagcctatccg
gatcacactccacatctcctcccaaagggcccattcgagcgcgcccgcgcccgcatctgg
atcgactttgtcggctcccgcatcacccccaattaccgcaagattcaatatgccaagagc
acagaggagcgggacgcggcgcgcgcagagttcctaaaggctgttaaggaattcacgcgc
gagatggatccggagggcccctatttccttggcgaggagattgggttgccggatattgcg
ctggcgccgtgggtggcgagattctttatggtggagaagtttaaggagggcgggactggg
atccctgcggagggcgagggagggaaggacgagggtgtttggcgtcggtggaggaagtgg
gaggccgcaattaaggggagggagagttttaagaatacgttcagtgagagggtgtattat
gagaatatagcgacgcaggaatgggcacggtga

DBGET integrated database retrieval system