KEGG   Histoplasma capsulatum: HCAG_01535Help
Entry
HCAG_01535        CDS       T02229                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00310  Lysine degradation
aje00380  Tryptophan metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_01535
  09105 Amino acid metabolism
   00310 Lysine degradation
    HCAG_01535
   00380 Tryptophan metabolism
    HCAG_01535
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     HCAG_01535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 5449993
NCBI-ProteinID: XP_001544488
UniProt: A6QVX8
LinkDB All DBs
AA seq 1054 aa AA seqDB search
MLQTATVKAFSNAAFLRRSSSAYNIRTFSVISSKPANTVSRSSSKLHLALRRPLAVLSRQ
QVWNQKRYYAVAAEESSKGVDPSDSFLQGNTANYIDEMYMAWKKDPTSVHVSWQTYFRNM
EDGNMPISQAFQPPPTLVPIPTGGVPQHMPHAGTASVAGTEVSNHLKVQLLVRAYQARGH
HKAKIDPLGIRGEAEAFGYNKPRELELDHYGFTESDLDQEFALGPGILPRFETETRKKMT
LREIIAACEKIYCGSYGIEYIHIPDRGPCDWIRDRVEIPTPYKYSIDEKRRILDRLIWSS
SFESFLATKFPNDKRFGLEGCETLVPGMKALIDRSVDYGIKDIVIGMPHRGRLNVLSNVV
RKPNESIFSEFSGTVEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPV
VLGKTRAIQHYNNDEKEFNTAMGVLLHGDAAFAAQGVVYETMGFHSLPAYSTGGTIHIIV
NNQIGFTTDPRFARSTPYCSDIAKAIDAPVFHVNGDDVEALNYVCQMAADWRATFKRDVV
IDIVCYRKQGHNETDQPSFTQPLMYKRIAEQTNQLDNKADIEEHKKWVWGMLNDSFDRSK
DYQPSSKEWLTSAWNGFKTPKELATEVLPHPPTGVPTETLKRIGDVLGSIPENFTVHRNL
KRILANRKKTVEEGENIDWSTAEALAFGSLCAEGHHVRISGQDVERGTFSQRHAVLHDQE
NETTYTSLQHISPDQGKFVISNSSLSEFGALGFEYGYSLTSPDAFVMWEAQFGDFANNAQ
CIIDQFIASGESKWLQRSGLVMSLPHGYDGQGPEHSSARIERYLQLCNEDPRVFPAPDRI
DRQHQDCNMQIAYMTTPSNLFHVMRRQMNRQFRKPLIIFFSKSLLRHPLCRSPLSDFTGD
SHFQWIIADPEHGSSSLNNHEDIERVILCSGQVYAALQKHRAAHGINNTAITRIEQMHPF
PWQQLKENLDSYPNAKDIVWCQEEPLNAGAWSYMQPRIETLLNETVHHNRRHVLYAGRNP
SASVATGLKASHVKEEQDLLQDAFSVHQDRLKGE
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaactgctacggttaaagcgttttcgaacgctgccttcctccgccgttcgtcc
tccgcctacaacatccggacattttctgtcatttcgtcgaaacccgccaataccgtgtcg
cggagtagctccaagctgcatctggccttgcgcagaccgctggctgttcttagccgccag
caggtatggaatcagaagagatattatgctgttgccgcagaagagtctagtaaaggagtg
gatcctagcgattccttccttcaagggaatactgcgaattacatcgatgagatgtatatg
gcttggaagaaggaccccacaagtgttcatgtctcgtggcaaacatacttccgcaatatg
gaagatggcaatatgcccatctcccaagccttccagcctcccccaactctcgtcccaatc
ccaaccggcggcgtgcctcagcatatgccccatgccgggaccgctagtgttgccggaacc
gaagtatcgaaccacttgaaagtccagcttctagtgcgcgcataccaggcccgtggacac
cacaaagcgaagatcgaccccctgggaatccgtggagaagctgaagcttttggttacaac
aaacctagggagttggagctggaccattatggattcaccgagagcgacctggaccaggaa
ttcgcccttggacccggtattcttccacgtttcgaaaccgagacgaggaaaaagatgacc
ctgagggagatcattgctgcttgcgagaagatttactgcggctcgtacggcatcgaatat
atccacatcccagacagagggccttgcgattggattcgtgatcgcgtcgagatccccacc
ccttacaaatactccatcgatgagaaacgccgtatcctggatcgcctgatttggagctcc
agtttcgagtctttccttgccaccaagttccctaacgataagcgtttcggtttggaaggc
tgcgaaaccctggttccgggaatgaaggccctaattgaccgtagtgttgactacggtatt
aaggatatcgtcattggtatgccacatcgtggtcgtcttaatgtgcttagtaacgttgta
cgaaaacccaacgagtccatcttcagcgaattcagcggcaccgtggagccctcggacgaa
ggatccggagacgtcaagtaccatcttggcatgaactttgagcgtcccacgccttcaggc
aagcgcgtgcagctttctctcgtcgccaacccgtctcatctggaggctgaggatcccgtt
gttctcggaaagactcgtgccatccagcattacaacaacgacgagaaggaattcaacacc
gccatgggggtgttacttcacggtgatgctgcatttgctgcgcagggtgtagtgtacgag
acaatgggattccattccctgcccgcgtactctaccggaggaacgatccacatcatcgtg
aacaaccaaatcggtttcaccactgatccccgctttgctcgttccaccccatactgttct
gatatagccaaggcaatcgacgcgcctgtcttccatgtcaacggggatgatgttgaagcg
ctgaactacgtttgccagatggcagctgactggcgcgccaccttcaagcgtgatgtggtc
atcgatatcgtctgctaccggaaacagggccacaacgaaacggatcagccttctttcacg
cagcccctgatgtacaagcgcatcgcagaacagactaaccaactggacaacaaggcggac
atcgaggagcacaagaagtgggtttggggaatgttgaacgacagcttcgatcgtagcaag
gactaccagccttccagcaaggagtggctgacctccgcatggaacggattcaaaaccccc
aaggagctggctacggaggtcctcccacacccgcccactggcgtccccacagaaaccctg
aagaggatcggcgacgtcctcggatccatccctgaaaacttcaccgtgcaccgcaacctg
aaacgtatcttggcaaaccgaaagaaaactgtcgaagaaggtgagaacatcgattggtcg
accgccgaagcgcttgcgtttggctcgctttgtgctgagggtcatcatgtgcgtatctcc
ggacaagatgtggagcgtgggaccttctcgcagcgtcatgctgttctgcatgaccaagag
aacgagactacatacacatcgctgcagcacattagccctgatcaagggaaatttgtcatc
tcgaattcttcgcttagcgagtttggcgctttgggttttgaatatggctactctctgaca
tcacccgatgcgtttgtgatgtgggaggctcaatttggtgatttcgcaaataacgcccaa
tgtatcatcgaccagttcatcgcatccggtgaatctaagtggctccaacgatccggcctt
gtcatgtcgctgccacatggttatgatggccagggtcccgagcattcctccgcgagaata
gaacgttacctccaactgtgtaacgaagatccaagagtgttccccgcccctgatagaatc
gaccgccaacaccaggactgcaacatgcagattgcctatatgaccacgccgtccaacttg
ttccacgtcatgcgcagacagatgaacaggcaattccgaaaacccctgataatcttcttc
tccaaatccctcctccgccaccctctctgtcgctcccctctctcagacttcaccggtgac
tcccatttccagtggataatcgccgacccagaacacggttcgtcttccttgaacaaccac
gaagacatcgagcgcgtaatcctatgctcaggccaagtctacgccgccctccaaaaacac
cgcgccgcgcatggaatcaacaacacagccataacgcgcatcgagcagatgcacccgttc
ccctggcagcagctcaaggagaacctggacagctatccgaacgcgaaggacatcgtctgg
tgccaggaggagccgctgaatgcgggcgcgtggagctacatgcagccgcgcatcgaaacg
ttgctgaacgagaccgtgcaccataaccggcgccatgtgctgtatgcaggccggaatccg
agcgcgagtgtggcgacgggtctgaaggctagccacgtgaaggaggagcaggatttgttg
caggatgcgttctcagtccatcaagatcgattgaagggtgagtag

DBGET integrated database retrieval system