KEGG   Histoplasma capsulatum: HCAG_01581Help
Entry
HCAG_01581        CDS       T02229                                 

Definition
(RefSeq) glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
aje  Histoplasma capsulatum
Pathway
aje00500  Starch and sucrose metabolism
aje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HCAG_01581
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HCAG_01581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 5451280
NCBI-ProteinID: XP_001544534
UniProt: A6QW24
LinkDB All DBs
AA seq 564 aa AA seqDB search
MAVSLFCGALLFVGLWSVFAGLWAGLVDLRPWPIQRPLLTNPLDAWIAKESSYALQALLA
NIGAEGAKAKGAVAGIVVASPSKKDPDYFYTWTRDASLVFKGLVDAFISGDTSLQSKIHE
YISAQAHLQTVSNPSGRLSSGGLGEPKFDVNMSSFNGDWGRPQRDGPALRATVMISYGKW
LIANGYANTARMIVWPVVQNDLSYVAQFWSSPGFGRHILLPLSDNCALTWYIDLWEEVDG
MSFFTTAVQHRALVEGSRFARQIGLRCPSCESQAPQVLCFMQNYWTGSYINSNTGGDRSG
KDTNSILASIHTFDPEASCDDLTFQPCSAKSLANHKVQKYAPVSGELAEQFSRDDGTPLS
ASDLTWSYASFLTAVSRRNSSVPDPWGQTAASSIPPTCQITSATGPYCTATNTKWPSDLT
SISRTISFSNGLTETKITATSTTTTTSPCVTPDSILVTFNEVATTTLGQRIFIIGSVPEL
GSWDIQSAIALSADQYTDDNRLWHRTIQLGAGLDFEYKYLRKESGESVSNATSYELEGGI
NAIPETGNPLSQMDDASRRSLFTQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcccttttttgcggagctttgctgtttgtcggcctctggtctgtatttgct
ggtctctgggccgggttggttgacctccgaccatggcccattcaaaggccccttttaacc
aacccattggatgcttggattgcaaaggaaagctcgtatgcgctacaggcactcctagcc
aatattggggccgaaggtgcgaaggcaaagggcgcagttgctggcattgttgttgcaagc
ccaagcaagaaggatcccgattacttctacacttggactcgagacgcgtctttggtattc
aaaggtctcgtggacgccttcatttccggggatactagtctgcaatcgaaaatccatgaa
tatatcagcgcgcaagctcatcttcagactgtttctaacccttctggacgcctatcatcc
ggtggccttggagaaccaaaatttgatgtcaatatgtcatcgttcaatggcgactggggt
cgtccccaaagagatggcccggccttaagagcaacggtaatgatttcttacggaaaatgg
cttattgcaaatgggtacgctaataccgcgaggatgattgtttggcctgttgtgcaaaat
gacctatcctacgtggcgcagttctggagcagtcctggctttggtcggcatattctactt
cccctgtccgataactgtgcactgacttggtatatagatctttgggaagaggttgacggc
atgtcgttttttacgacggcagtgcagcatcgtgctcttgtcgaaggttccagattcgcg
cgccagataggactcagatgcccgagctgtgaatcccaagctccccaggtcctctgtttt
atgcaaaactactggacagggtcgtatatcaactccaacaccggtggtgaccgctctggt
aaagatactaactccatccttgcaagtatccacacttttgaccctgaggcttcatgtgat
gacttgacatttcagccctgttctgcaaaatcgttagcaaaccacaaagtgcaaaaatat
gcccctgtttccggcgaactagccgagcagttttctcgagatgacggaacccctctttcg
gcctccgatttaacatggtcatacgcctcgttcctgacagctgtttcccggcgtaattca
agtgtcccggacccctggggccagacagctgccagtagcatcccgccgacctgccaaatt
acatcagccacgggaccttactgcacagcaaccaataccaaatggccttcagatcttact
agcatctcgagaacgatttcattctccaacggactcacggaaactaaaatcactgctact
tcgaccactacaactacatccccatgtgtcactcctgactcaatcctggttacattcaac
gaagtcgccacaacgacccttggacagaggatcttcataattggctctgttccagagctc
gggtcctgggacattcaatctgcaattgcgctctccgcagaccagtataccgatgacaat
cgtttatggcatcgaactattcaattgggtgcagggctggacttcgagtataagtacctt
cgtaaggaatcgggcgagagtgtttcaaatgccacatcgtatgagctggagggcggtatc
aacgccattccagaaacgggaaatcctctgtcacaaatggatgatgcttctagaagaagc
ctctttacgcagtaa

DBGET integrated database retrieval system