KEGG   Histoplasma capsulatum: HCAG_01582Help
Entry
HCAG_01582        CDS       T02229                                 

Definition
(RefSeq) alpha-amylase A precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00500  Starch and sucrose metabolism
aje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HCAG_01582
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HCAG_01582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 5451078
NCBI-ProteinID: XP_001544535
UniProt: A6QW25
LinkDB All DBs
AA seq 497 aa AA seqDB search
MMKFTIINVSVSILAVAKAVVAATPAEWRSQSIYFLLTDRDFAVGPGKESSRRYPSEPFL
SQIGTLPNTFWKLDYIQKMGFTAIWITPVTKQFPERSGYGEAFHGYWQQDLYAVEPHLGS
ADDLRVLSAALHERGMYLMVDVVANHMGYPGSSSSMDYSRYVPFNNYIYFHPYCPITDYN
NQPMVEHLGDIPEYLPFRPLLVLAVQNTLVLELTITAVDGLRIDTAKHVRKPFWKEFNFA
AGVYSMGEVYHGDPGYACDYQNYIDGLVNYPMYGHGYIANGYYPLIEAFKSPSGNMANLY
NMINTVKDNCPDSTLIGTFSENHDTPRFANYTNDLSLAKSVLVFTILADGIPIVYAGQEQ
HYSGGNDPYNREATWLSGYNTESPLFKLTAKANRIRKKAIADDANYLTYKNYPIYQDQNT
IAMRKGFDGKQIITVLSNLGSGGASYTLQLGGTGYPAGMRVTDIYTCTSSVVASNGQLPV
PMGAGEPRILYPKKEYE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattcactatcattaatgtttcagtgtctattctggctgttgcaaaagctgtt
gttgcggcaactccagcagagtggcgttcgcaatcgatatatttccttctcacggacaga
gattttgcggtgggacctggcaaggaatcatcaagaaggtacccttcagagcccttcctg
tctcagattgggaccttgcctaacacgttttggaagcttgattacatccagaaaatgggg
tttactgctatatggattactcctgtgacaaaacagttccccgagagatcggggtatgga
gaggcgttccatggatattggcaacaagatttgtatgccgtggagccccatcttgggtct
gcagacgatctcagggtattgagcgcagcactacatgaacgtgggatgtatctcatggtc
gacgtagtagcgaaccatatgggctatcctggctccagcagcagtatggattatagtcga
tatgtcccgtttaataactatatctattttcacccttattgccccatcaccgattacaac
aatcaacctatggttgaacatttgggtgatattcccgaataccttccgtttcgccctcta
cttgttcttgctgttcaaaataccctagtcttggaactaacaattactgcagtcgacggt
cttcgaatcgacactgcgaagcatgtacggaagccattctggaaggagttcaatttcgcc
gcaggagtatattccatgggtgaagtgtatcatggtgacccaggttacgcctgtgactac
cagaactatatcgatggtttagtgaattacccaatgtatggtcacggatacattgccaat
ggctattaccctctcattgaagcctttaaatcaccaagcggcaatatggcaaacctatac
aatatgatcaatacagtgaaggacaattgtccagattccacactaataggcaccttctca
gagaatcacgacactccaaggttcgcaaattataccaacgacttgtctctcgctaaaagt
gtcctggtcttcacgatcctcgcagatggaattcccatagtctatgctggccaagaacag
cactattcgggcgggaatgatccatacaaccgtgaagcaacctggctgtcgggctataac
actgaaagtcctctattcaagctcacggcaaaagccaatagaatccggaagaaagccatt
gcagacgatgccaactatcttacatataaaaactatcccatctaccaagaccaaaacacc
attgcgatgcgcaaaggtttcgatggcaaacaaattatcactgtactctctaaccttggc
tctggcggggcttcttacacgttgcagctgggtggcacgggctatccggccggcatgcgg
gttaccgatatttacacgtgcacgtcttctgtggtggcttctaatgggcagctaccagtg
ccgatgggtgcgggcgagccgaggatcctgtacccaaaaaaggagtatgaatga

DBGET integrated database retrieval system