KEGG   Histoplasma capsulatum: HCAG_02211Help
Entry
HCAG_02211        CDS       T02229                                 

Definition
(RefSeq) similar to alpha-glucosidase B
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aje  Histoplasma capsulatum
Pathway
aje00052  Galactose metabolism
aje00500  Starch and sucrose metabolism
aje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HCAG_02211
   00500 Starch and sucrose metabolism
    HCAG_02211
Enzymes [BR:aje01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     HCAG_02211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 5449177
NCBI-ProteinID: XP_001542040
UniProt: A6QXV4
LinkDB All DBs
AA seq 911 aa AA seqDB search
MKPAFLLLPSLVGATCRLPQYPLPIDKCPGYKASNVHELENILIADLQLAGQPCNTYGQD
LKELRLRVEYETDSRLHVKIYDPDEDIYQVPEAVFPRPHLERGDHKSLLKFSYVEAPFSF
SVSRRGNGEVLFDTAGTNLVFQSQYLNFRTSLPTNPNLYGMGEHTNPFRLNTTNYTATLW
NRDAYGIPLGTNLYGDHPVYIDHRGESGTHGVFLLNSNGMDVKVNRTEKGGQYLEYNSLG
GIIDLYFFAGPTPKEVASQYAQVVGLPTMMPYWGFGFHQCRYGYRDIFDVAEVVYNYSQA
NIPLETMWTDIDYMDRRKVFTLDPKRFPIKKVRELVDYLHERDQHYIVMVDPAVAYSDNG
AFNRGAEQGIFLKKADGSIYKGVVWPGVTAFPDWFHPNTENYWVNEFAQFFDEQTGVDID
GLWIDMNEPANFCSYPCEDPEKFAIDNKFPPEPPTVRPNPRPIPGLPSTFQPLHSDAKRA
GEHGHKMGLPNRMLIDPPYKINNQVGSISNKTVDTDIVHANGWVEYDVHNIFGSSKPFFS
SHLSDLQPFGSAINYHCSDEPGISDCNAQETTVREAVAFVSISDKNFENRLGDNLSTWEK
YRTSIGQMLAFASIFQIPMTGSDVCGFGGNTTEQLCSRWAMLGAFSPFYRNHNGIDSESQ
EFYRWKLVAEAARKAIEIRYKLLDYIYTAFNRQARTGEPLLNPLFYLYPKDPNTFAIDLQ
FFYGDAILVSPVTEENYTSVDIYLPDDIFYDYYTGKPVRGEGKSVTLNDVDFTHIPLHIR
GGNIVPLRANSANTTKTLREQPFNIIIAPGLDGDATGSLYLDDGESLEQKHTMEIKFSYN
KGQFKMEGKFDPKAIGQLKIASISVLGHDGKAAEFTMEGGGGSRYEYNAETEVFSTRVDW
PLTGPAQLKLS
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcttttttgcttcttcctagccttgtgggcgccacttgtcggcttccacag
tatccacttccaatcgataaatgtcctggatacaaagcttcgaatgtccatgaattagag
aacattctcattgcggacttgcaactcgcggggcagccatgtaatacctacggccaagac
ttgaaggaattgaggcttcgagtcgaatatgaaaccgattcacgacttcatgtgaaaatt
tatgaccctgatgaggatatttaccaggttccggaggcggtgtttcctcgcccacatctt
gaacggggagaccacaaatctttactgaagttttcttacgtggaagcccctttttccttt
tctgtgtcacgaagaggtaatggcgaggttctcttcgacacagcagggaccaatctcgtc
tttcaatcgcaatatttgaatttccgtacttcactaccgacaaacccaaatctctatggc
atgggcgaacacaccaatcccttccgtctaaataccacgaactatactgcaactctgtgg
aatcgcgatgcatacggaatccctctagggaccaacctgtatggtgaccaccccgtctac
atagatcacagaggtgaatccggtactcatggtgtattcctccttaactcaaacggaatg
gatgtcaaggtcaacagaactgagaagggtggccaatatctagaatataattctttaggt
gggatcattgacctttacttcttcgcggggccgacccccaaagaagtcgcgtctcaatac
gctcaggtggtgggattgccgaccatgatgccgtactggggattcgggtttcatcaatgc
cgctatgggtatcgggatatttttgatgtcgccgaggtggtctacaactacagccaagcg
aatattccccttgagacaatgtggacagacattgactatatggatcgtcggaaggttttt
accctagatcccaagcggtttccgataaagaaagttcgggaactcgtggactacttacac
gagcgtgaccaacattatattgtaatggttgatccggccgtggcctattctgataatggg
gcattcaacaggggtgctgagcagggtatctttttgaaaaaagctgatggttcaatatac
aaaggtgtcgtatggcctggtgtgacggctttccctgactggttccatccaaacacggaa
aactactgggtgaacgaatttgcccaatttttcgacgagcaaacaggtgtagatattgac
ggcttatggattgacatgaatgagcctgcgaatttctgttcctatccttgtgaggatcca
gaaaagttcgccatagataacaagttccctcctgaaccgcctacggtgcgaccgaatccg
cgacccattccaggacttccatcaaccttccagccactccatagtgatgccaagagagcc
ggtgaacacggccataaaatgggcctgccaaaccgcatgctgatagacccgccgtataag
atcaataatcaagtagggtctatcagcaacaaaacggtggacaccgatatagtccatgca
aatggatgggttgagtacgatgtacataacattttcggaagcagtaagcctttcttttca
agccatctatccgatttacaaccttttggatcggcgattaactaccattgcagtgatgag
ccgggtatctcggactgcaatgctcaggagacgaccgtccgtgaggccgttgcttttgtc
agcatttctgacaaaaattttgagaacaggctcggcgataatctgagtacctgggaaaag
tacaggacatcaattgggcagatgcttgcttttgcatccatcttccaaataccgatgacg
gggagtgatgtttgtggctttggaggtaatacaactgagcaactttgctccagatgggcg
atgcttggtgcattcagcccgttctaccgcaaccataacggcatcgactctgaatcccaa
gaattctaccgatggaaattggtcgcagaagccgcacggaaagcgatcgaaatcagatac
aagctgctcgactacatttacacggcattcaaccggcaggcaaggaccggtgaacctctc
cttaatccgctattctacctttatcctaaggacccaaataccttcgcgatcgaccttcaa
tttttctacggagacgccatcctagtaagcccggtgacggaagagaattacacgagcgta
gacatctatctgccagacgatatcttctatgattactacactggcaaaccggtccgcggc
gaaggcaaatccgtcactctcaacgatgttgatttcacccacatccctctccatatccgc
ggtggaaacatcgtcccgctcagagctaatagtgccaacacaactaaaaccctccgtgag
caaccctttaacatcatcattgcgccgggtcttgatggcgatgctactggaagcctatac
cttgacgatggtgaatctctagaacagaagcatacaatggagatcaaattttcgtataac
aaagggcaattcaaaatggagggcaagttcgaccccaaagccattggccagttgaaaatt
gcgtctatctccgtgcttggtcatgacgggaaggcagccgaatttaccatggagggtggt
gggggctctcggtacgaatataatgccgaaactgaggtattttccacgagggttgactgg
ccgttgacggggccggcgcaattgaagctttcgtga

DBGET integrated database retrieval system