KEGG   Histoplasma capsulatum: HCAG_02557Help
Entry
HCAG_02557        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aje00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HCAG_02557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aje01001]
    HCAG_02557
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aje03032]
    HCAG_02557
   03400 DNA repair and recombination proteins [BR:aje03400]
    HCAG_02557
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HCAG_02557
Protein kinases [BR:aje01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   HCAG_02557
DNA replication proteins [BR:aje03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     HCAG_02557
DNA repair and recombination proteins [BR:aje03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    HCAG_02557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC FAT TPR_14 SUKH-4
Motif
Other DBs
NCBI-GeneID: 5448997
NCBI-ProteinID: XP_001542386
UniProt: A6QYV0
LinkDB All DBs
AA seq 792 aa AA seqDB search
MLSTSLHLQQWDIPVMCSQNLDQLQDAWERIQAKGSWLKFESFRDASLKCAISLSKLIKP
CAELGVFIDAAATFDLANVLWDQGEMTTSIQMLQQLSEQNDLQNQSIAVNKAEILASLGR
HVAEARLQKPDTIMQEYLLPAIKELKGKSEGEEAGRVFHEFAVFCDQQLQNPDSLEDFRR
IEQIRHRKEREVLDLEQMIESARNKERESLLMHISRAKQWFELDDKEYQRLKESRVSFLR
QCLEKYLLSLKASDKFKNNVLRFCALWLDNSESEAANGSVAKYINAVPSRMFAPLMNQLS
SRLLDVEDSFQPLLANLIFRICREHPYHGMYQIFNSSRSTRGRDHMGTSRYRAANSLVDR
LKVDPKACATWLTLHNTNVIYVRFATDRLDNGLKSGSKVALRKTVAGQRLEQDIRRQRIP
PPTMKIDLRIDCDYSQIPRIVRYLPEFTVASGVSAPKIVSAIASDGLLYRQLFKGGNDDL
RQDAIMEQVFEQVSDLLRENRATQQRNLGIRTYRVLPLTTGAGIIEFVQNTIPLTDYLMP
AHQKQFPKDMKPNACRKLISDAQQKSLENRVKVFREVINQFHPVMRFFFMERFKEPDDWF
SKRLAYTRSTAAISMLGHVLGLGDRHGHNILLDEKTGEVVHIDLGVAFEQGRVLPIPEVV
PFRLTRDLVDGMGVTKTEGVFRRCCEFTLEALRRESYSIMTILDVLRYDPLYSWSLSPLR
IKKMQDTQEAAEGAAHVNESGKSKNPNEPSEADRALTVVAKKLGKTLSVAATVNELIQQA
TDERNLALLYCG
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaacttcgcttcacctacagcagtgggatatcccagtcatgtgttctcaaaat
ctggatcagttacaagatgcatgggaaagaatacaagctaagggatcgtggctgaagttt
gagagtttccgggacgcgtctttgaaatgcgcgatttcgctttcgaaactaatcaaaccc
tgcgctgaactgggcgtatttattgacgcagcagcaacatttgatttggcaaatgtgctt
tgggaccagggggagatgacaacctcaatccagatgttacaacagcttagtgagcagaac
gacctccagaatcaatctattgcagtgaacaaggcggagattttggctagtctaggtcgc
catgttgcggaagctaggttacaaaagccggatacgattatgcaggaatatcttcttccc
gcaataaaagagttaaagggtaaatccgaaggggaggaagctgggcgggtattccatgaa
tttgcagttttctgtgaccaacaacttcagaatccagacagcctggaagatttcaggaga
attgaacaaattcgtcatcgaaaagagagagaagtattagatctcgagcaaatgatagag
tcggcaagaaacaaagagagagagtcacttctgatgcacatatccagagcgaaacaatgg
tttgaactggatgacaaagagtaccagcggctgaaggagagtcgggtatctttcctccgg
cagtgcctagaaaagtatctcctttccttgaaggcatccgataagttcaagaacaatgtc
ctacggttctgtgctctctggttagacaattcggagagcgaagcagccaatggttctgtc
gcaaaatacattaacgctgtgcccagtcggatgtttgcgccattgatgaatcaattatcg
tcgcgtctgcttgatgttgaggatagtttccagccgctgctagcaaatctcattttccgg
atttgcagggaacatccataccacggaatgtatcagatatttaacagcagcagatccacg
cgtggtagagaccatatgggcacttcccgataccgagccgccaatagcttagttgaccgt
ctgaaagtagatccaaaggcgtgtgctacgtggctcactctacacaacacaaacgtcata
tacgtgaggtttgcaacggacaggctagacaatggactaaagagcggttcaaaggttgca
cttagaaagacggtcgccggacaacgattagaacaagacatcagaagacagcgtattccg
ccaccaaccatgaaaattgatctccggattgattgcgattacagccaaataccccgtatt
gtgaggtatctcccggaattcactgtcgcatctggtgtcagtgctcccaaaatcgtctcc
gctatcgcttcagacgggcttttgtatagacaactctttaagggagggaatgatgacttg
cggcaagatgccattatggaacaagtctttgaacaagtcagtgacttgttgcgagagaat
cgggctacccagcagcgcaacttaggcatcagaacatatagagtgctgcctctaactacg
ggtgcgggaatcatcgaatttgtgcaaaatacaattccattaaccgactatctaatgccc
gcccaccaaaaacaatttcccaaagatatgaagcccaacgcctgtcggaagcttatcagc
gatgcgcaacaaaaatcattggagaatagagtaaaagttttccgtgaggtaataaaccag
ttccacccggtcatgaggttcttctttatggagaggttcaaagagccagacgattggttt
agcaaacggcttgcgtacacacgaagcaccgctgccatttccatgctgggtcatgtgctc
ggcttgggcgatagacatggccataatatcctacttgatgagaagacgggtgaagtagtc
catatcgatctaggagtagcctttgaacagggacgcgtcctaccaatccccgaggtggtg
cctttccgtttgactcgtgatctcgttgatggtatgggcgtgaccaaaacagagggagtt
ttcaggcgatgctgcgaattcacccttgaagctctgcgccgagagtcatatagcattatg
acgattctcgacgttcttcgttatgaccccctttacagttggtcgttgtccccactgcgt
atcaaaaaaatgcaagacacccaggaggccgctgagggcgcggctcacgtcaatgaaagc
ggcaagagcaagaacccaaatgagccgagtgaggctgatcgagccttgacagttgttgca
aagaagcttgggaagacgcttagtgtcgccgctactgttaatgagttgattcaacaggcg
acagatgaacggaatcttgctcttctgtattgcggttag

DBGET integrated database retrieval system