KEGG   Histoplasma capsulatum: HCAG_03222Help
Entry
HCAG_03222        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
aje  Histoplasma capsulatum
Pathway
aje04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aje00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    HCAG_03222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aje04131]
    HCAG_03222
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aje04812]
    HCAG_03222
Membrane trafficking [BR:aje04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    HCAG_03222
Cytoskeleton proteins [BR:aje04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     HCAG_03222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 WH2
Motif
Other DBs
NCBI-GeneID: 5447562
NCBI-ProteinID: XP_001541125
UniProt: A6R0R5
LinkDB All DBs
AA seq 765 aa AA seqDB search
MPSILTDADKETVRRTVPKPSNRILAVAVARLYVAHPNPQKWTYTGLQGAAVLANDLVGH
TFWIKLVDVSPAGRGVVWDQEIYDGFSYNQDRTFFHTFELEECLAGLSFADEKEAKTFLK
KVQEREKSASKETKTTPFSSLRGQGPPPTTGGKSHSRFGLGSLLHHGHRSSSAPTHSAAP
AESIIPPRQPTPPPAPAPPPTVTELPTSPQRKQTSALDTIDPSWKGLLDELLAMGITEDQ
IAENSDFIKAYIEQKQADELNGISKEASPDSQRKAKAPPPPPPPNAPPAAALSPQNTGKR
GAPPPPPPARRGRAPSPPPAREPSPPSPPREPSPVRPRFKAPPPIADAGKFANALPRSHR
ASSGSNAARPGVPAPPLPPKTPLEGERKVSAPQLPSRNPVLPARREVSPGLPPALPPKIP
HATPPPPPPRPQASPTSTPQSQHLLPPQTAPGPLPVRPAPPPTSAPAPPPPPPPAPAPGP
VPSSSPTPPPPPPPPPAPAPASTGPAPPPPPPPPPTAGLPRPPPRPAPSNSVPPPPPPSA
GAPPPPPPPSAGAPPPPPPPPPPGSAANSAGPPPPPPPASSARPSSLPKSPGNADLLASI
RAGTGLRKVKDSEKRDRSAAVVPGASSETPSSPASGAGSADPNSMLGSLQAALNKRKQKV
SGSDDEKSDNECYGACCNGVEAVSRNEQLLHISSTERNQDWKLAERQNSRDDNLPDIINN
LEFEGENSANFRKVDATWSVPRELSNSGTKTKRPSRTQQLLTDKA
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgccatccattcttaccgatgcggataaagagactgtccggcgaacggttcccaaaccc
tccaacagaatactggcggttgcagttgcgcgattatacgtagcacatccaaatcctcaa
aaatggacctacactggactacaaggagctgcggttcttgctaacgacttggttgggcat
acattttggattaagttggttgatgtttcgcccgctggtagaggcgttgtatgggaccag
gaaatttatgatggcttctcctataaccaggataggacctttttccacacgttcgagctg
gaggaatgtcttgcgggattatcgttcgcagatgagaaggaggcaaagactttcttaaaa
aaggttcaagagcgagagaagagtgcgagtaaagaaacaaagacgactccattttcctcg
ctccggggtcaaggaccgcctccaacaacaggcggcaaaagtcatagtcgttttgggctc
ggtagcctccttcatcatgggcatcgatcctcctccgcgcctacccattccgccgctcct
gcggaatctattatacccccaagacagcctactccacctcccgcccccgccccccctcca
acagtaacagagcttccaacaagcccgcaacggaagcagacgtctgccttagatacgata
gatccgtcatggaagggcttgctcgacgagctacttgccatgggcattacagaggaccaa
atagcggaaaattcggactttatcaaagcgtatatcgagcagaagcaggccgatgagctg
aacggtatatccaaggaagcctcgccggattcccaaaggaaagcgaaagctccacctccg
cctccaccaccaaatgccccaccagcggcagccctcagcccccagaatacaggaaagagg
ggtgcacctcctcctccgccaccagcacgacgtggccgcgctccctccccaccacctgca
cgcgagccttctcccccatccccgcctcgggaaccttcgccagttcgaccacgcttcaag
gcaccccctcccatcgcggatgcgggcaaattcgccaatgctctcccgcgcagccatagg
gcttcatcaggttcaaatgcagcccggccgggagtaccagccccgccgctgccaccaaaa
actcctttggaaggagaaagaaaagtgtccgccccacaactgcccagtcgaaacccagtc
ctcccggctcggcgtgaagttagtcctggattacctcccgctttaccacccaagattccc
catgctactcctccgcccccgccaccacgccctcaagcttctccaacttcaactccccag
tcacaacacctgctgccgccacaaacagccccaggaccactcccagtgcgtcctgcaccg
ccgcccacatcagctccggcaccgccgcctcctccgcctccggctcctgcaccaggacca
gtaccgtcatcgagccccacgccacctccacctccacctccgcctccagctccagctccc
gctagcactggacctgccccgcccccgcccccgcccccgcctccgactgctggtcttcct
cgccctcctccccgtcctgcaccttcaaatagtgtccctccacctcctccgccctctgca
ggcgcccctccacccccacctcctccatctgctggtgcgcctcctcctcctcctccgccg
ccgccgccaggttccgcagctaacagcgctggtcctccgccgccgccgccgccagcgtca
tcagcacgcccgtcgtcccttcccaaatcaccagggaacgccgatcttctagcttcaatc
cgtgcaggaacaggtcttcgaaaagtcaaagacagcgagaaacgagatcgaagcgctgct
gtggttccaggtgcaagcagcgaaactccttcctcaccagcgtcaggcgcggggagcgca
gatccaaattcgatgctggggtctcttcaagcggcattgaataagcggaagcagaaagtt
agcggtagtgatgatgaaaagtccgataatgagtgctatggagcatgctgcaacggagtt
gaagcagtcagccgaaatgagcagttactccatatatcaagcactgagcgcaatcaggat
tggaaattggcagaacgccagaattcaagggacgacaacctgccagatataatcaacaac
ctggaatttgagggtgaaaactcagccaatttccgcaaagtagatgctacatggagcgtt
cctcgggaattgagtaactccggaactaaaaccaagagaccctctcgaacgcaacagctg
ttgacagacaaagcataa

DBGET integrated database retrieval system