KEGG   Histoplasma capsulatum: HCAG_03263Help
Entry
HCAG_03263        CDS       T02229                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein, mitochondrial precursor
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00190  Oxidative phosphorylation
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aje_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_03263
  Energy metabolism
   00190 Oxidative phosphorylation
    HCAG_03263
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HCAG_03263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 5447558
NCBI-ProteinID: XP_001541166
UniProt: A6R0V6
LinkDB All DBs
AA seq 283 aa AA seqDB search
MASLRPTSRLLAASRPLFLTSVASRSYATVESASKVADQSTPSTLQSPRLKTFKIYRWNP
DKPTEKPYMHDYTLDLNKTGPMVLDALIRIKNEQDPTLTFRRSCREGICGSCAMNIDGVN
TLACLCRIPTETTKESRIYPLPHTYVVKDLVPDLTYFYKQYKSIKPYLQRDTPSPDGREI
RQSPADRKKLDGLYECILCACCSTSCPSYWWNSEEYLGPALLLQSYRWLIDSRDEKTEER
KAHLDNSMSVYRCHTILNCTRTCPKGLNPGLAIAEIKKMMAFA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctacgccctacatcccgcctactcgcggcctctcgacctctattcctcacc
tccgtagcctcgagatcttatgccaccgtggagtctgcatccaaggtcgcggatcaatct
accccatcgactttgcaatccccaagactcaagaccttcaagatctacagatggaacccg
gacaagcccaccgagaagccttacatgcacgactatactctcgacctgaacaagaccggc
cccatggtgctagatgccctgatcagaataaaaaacgagcaagatccgaccttgaccttc
cggagaagttgcagagagggcatctgcgggagctgtgccatgaacattgatggcgttaac
accctggcttgcttatgccgtattcctaccgagaccaccaaagagtccagaatctatcct
ctccctcacacctacgtggtcaaagatctagttcccgatctgacctacttctacaagcaa
tacaaatcaatcaagccatacctacagcgtgacacaccttctccagacggccgcgaaatc
cgccaatcgcccgcagaccgcaaaaaactcgacggtctttacgagtgcatcctgtgcgcc
tgctgctcaacctcctgtccatcctactggtggaactcggaagaatacctcggccccgct
ctcctgctgcagtcttaccggtggctaattgattcgcgtgacgagaaaaccgaggagcgc
aaggctcacctcgacaacagcatgagtgtatacagatgccacaccattctcaactgcacg
aggacgtgccccaagggattgaaccccggtctggccattgcggagattaagaagatgatg
gccttcgcgtaa

DBGET integrated database retrieval system