KEGG   Histoplasma capsulatum: HCAG_03661Help
Entry
HCAG_03661        CDS       T02229                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00010  Glycolysis / Gluconeogenesis
aje00051  Fructose and mannose metabolism
aje00052  Galactose metabolism
aje00500  Starch and sucrose metabolism
aje00520  Amino sugar and nucleotide sugar metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HCAG_03661
   00051 Fructose and mannose metabolism
    HCAG_03661
   00052 Galactose metabolism
    HCAG_03661
   00500 Starch and sucrose metabolism
    HCAG_03661
   00520 Amino sugar and nucleotide sugar metabolism
    HCAG_03661
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HCAG_03661
Enzymes [BR:aje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     HCAG_03661
Membrane trafficking [BR:aje04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    HCAG_03661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2
Motif
Other DBs
NCBI-GeneID: 5447546
NCBI-ProteinID: XP_001541563
UniProt: A6R203
LinkDB All DBs
AA seq 460 aa AA seqDB search
MAITPRRKPSRKGSMADMPKDVLDQLKTLEELFTVDQEKLKQIVEHFIKELQKGLSVEGG
NIPMNVTWVLGFPTGHEKGTFLALDMGGTNLRVCEIELSEEKGEFDVTQSKYRIPEELKS
GESSELWEYIADCVQQFIEYYHDGCTALPDLPLGFTFSYPATQEYVDHGVLQRWTKGFDI
DGVEGKDVVPMLEEALAKKVKNSALSPFFFGYMVLITLQGLPIKVAALVNDTTGTLIASA
YTDPEMKIGCIFGTGVNAAYMENAGSIPKIAHYNLPPDTPVAINCEYGAFDNELIVLPRT
QYDDVSQLRKPYSLDSSFLAFIEEDPFENLSETRDLFERTLGIYALPSELEFCRRLAELI
GTRAARLSACGVAAICKKKNITHCHVGADGSVFEKYPHFKARGARALREILDWPDSEPDR
VVMSGAEDGSGVGAALIAALTLERVKQASWEWKYIGSGLS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggctataacaccccgccgaaaaccttcccggaagggatcaatggctgatatgccgaag
gatgtgcttgaccagctcaagacgctggaagagctcttcacagttgaccaggagaagctg
aagcagatcgttgagcatttcatcaaggagttacagaagggcctcagtgtcgaaggcgga
aacattcccatgaacgtgacttgggttctgggatttcccactggccatgagaaaggtaca
tttctggctctggacatggggggcaccaacctgcgcgtctgcgaaattgagctctccgaa
gagaagggcgagtttgatgtcacacagtccaagtatcgaatccccgaagagctcaagagc
ggtgaatcatcagaactatgggaatatattgccgactgtgtacagcagttcatagaatac
taccatgacggttgcacggctttgccagacctgccgctgggctttaccttttcgtaccct
gctactcaagaatatgttgaccacggtgtcctacagagatggaccaagggttttgatatt
gacggcgtcgagggcaaagacgtcgtcccaatgttagaagaagctttggctaagaaggtt
aaaaattcagctctttccccatttttctttggctatatggtgctaattactttacagggt
ctccccattaaagttgccgctctagtaaacgacacgactggcacacttattgcttccgcc
tacactgacccagagatgaaaatcggctgtatcttcggcacaggcgtcaacgccgcctac
atggaaaatgcgggctctatccctaaaatagcccactacaatttacctcccgacacccca
gtcgctatcaactgcgaatacggcgccttcgacaacgaactcattgtcctcccccgaacg
cagtatgacgacgtatcccaactacgtaaaccatactccctggactcctccttcctagcc
ttcatcgaagaagatcccttcgagaacctgtcagaaacgcgagatctcttcgaacgcacc
ctggggatctacgcattgccctcggagctagaattctgcagacgcctggcggaattgatc
ggcacacgtgccgcacgcctctccgcttgcggtgttgcggccatctgcaagaagaaaaat
atcacccattgccatgtcggagcggacgggtcggtgttcgagaagtacccgcatttcaag
gccaggggcgccagagccctgcgggagatccttgactggccagatagtgaaccggatcgg
gttgtgatgagcggagcggaggatgggtctggcgttggtgcggcgcttattgcggctttg
acgcttgagagggttaaacaagcttcttgggaatggaagtacatcggaagcggtctgtct
taa

DBGET integrated database retrieval system