KEGG   Histoplasma capsulatum: HCAG_06317Help
Entry
HCAG_06317        CDS       T02229                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aje  Histoplasma capsulatum
Pathway
aje00020  Citrate cycle (TCA cycle)
aje00190  Oxidative phosphorylation
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
aje01130  Biosynthesis of antibiotics
aje01200  Carbon metabolism
Module
aje_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aje_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aje_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HCAG_06317
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HCAG_06317
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HCAG_06317
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5444874
NCBI-ProteinID: XP_001538712
UniProt: A6RBH9
LinkDB All DBs
AA seq 637 aa AA seqDB search
MSFSGLRSLASATRVWHLRFPSSSAPKPFFPTHLRIKDVYFLLHVPQDHEYDAVVVGAGG
AGLRAAFGLAEAGFNTACVSKLFPTRSHTVAAQGGINAALGNMHEDDWRWHMYDTVKGSD
WLGDQDAIHYMTREAPQSIIELEGYGCPFSRTEDGKIYQRAFGGQSQKYGKGGQAYRCCA
AADRTGHALLHTLYGQSLRHNTNYFIEYFALDLLMEDGECKGIIAYNQEDGTIHRFRAHN
TVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPEKDHIYLQLSHL
PAEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMGGIPTRYTGEVLTLDEKGQDK
VVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDKSSPGQPHKEISADAGA
ESISVLDKVRTAEGSKSTFDIRNAMQKTMQTDVSVFRTQESLDEGVRKIKEVDQMFDDVG
TKDRSMIWNSDLVETLELRNLLTCATQTAVAAANRKESRGAHAREDYPDRDDENWMKHTL
TYQKQPHGKVDLTYRAVNPNTLDANECKPVPPFKRTY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttccggattgcggagcctggcttccgcgacgagggtatggcacctacgattc
ccctcgtcctcagcacccaagccattttttccaacgcatttaaggatcaaagacgtctat
tttcttcttcacgtcccacaggaccacgaatatgatgccgtcgttgttggagctggtggt
gctggtctccgtgctgccttcggccttgcggaggcaggtttcaacacagcttgtgtttca
aaattatttcctacacgaagccacacggtagcagctcagggaggtattaatgctgccctt
ggaaatatgcacgaggatgactggagatggcacatgtacgataccgtcaagggatccgat
tggctgggtgaccaggatgctatccattacatgacaagagaggcacctcaaagtatcatt
gaacttgaaggatatggatgtccattttcgagaacagaggacggtaaaatctatcagcgt
gctttcggtggacagtctcagaagtacggcaagggaggccaagcttaccgatgctgtgct
gctgctgacagaaccggacacgctcttcttcacactctttacggccaatcactccgacac
aacaccaactattttatcgaatatttcgcattggatcttctcatggaggatggtgaatgc
aaaggcataattgcatacaatcaagaagatggcactattcatcgcttccgcgcacacaac
accgttcttgcaacaggaggatacggccgtgcttacttcagctgcacatccgcccacact
tgtaccggtgatggtatggccatggttgcccgtgctggcctgcccaaccaggatctggaa
tttgtccaattccaccccacgggtatctatggtgcgggttgtcttatcacagaaggttct
cgaggcgaaggtggctatctgctgaactctgagggtgagagatttatggaacgatatgct
ccaactgccaaagatctggctagtcgagacgttgtttcgcgatcgatgactctcgagatc
cgcgagggacgtggtgttggccctgaaaaggaccatatatacctgcaactcagccatctt
cctgctgaaatcctccatgagcgattgcctggtatctcagaaaccgcatccatttttgcc
ggcgttgacgttaccaagcaacctattcccgttctcccaactgttcactataacatgggc
ggtatcccaactcgttataccggcgaggttctcacgttagatgagaagggtcaagataag
gtagttccgggcttgtatgcttgtggcgaagccgcttgtgtttctgtccatggtgccaac
agacttggtgcaaactcgctgcttgatctcattgtattcggccgggcagtctcccacacc
attcgtgataagtcatcgcctggtcaaccacataaggagattagtgcagatgctggagct
gaatcgattagcgttcttgacaaggtcagaactgcagagggatctaaatcgacatttgac
attagaaatgctatgcaaaagactatgcaaactgatgttagcgttttccgaacgcaagaa
agtttggatgagggtgtccgcaaaattaaggaggttgatcagatgtttgatgatgtggga
accaaggaccgcagcatgatttggaattccgatctcgttgagactctcgaactgagaaac
ttgctgacttgcgctacgcaaactgctgttgccgctgccaaccgcaaggaatcccgtggt
gcacatgcccgcgaggactacccagaccgtgatgacgagaactggatgaaacacacattg
acctaccaaaagcagcctcatggcaaggtcgaccttacctaccgtgcggtaaatcccaat
acgctcgatgcgaatgagtgcaagcctgtgccgccattcaagcggacgtattag

DBGET integrated database retrieval system