KEGG   Histoplasma capsulatum: HCAG_06585Help
Entry
HCAG_06585        CDS       T02229                                 

Definition
(RefSeq) similar to glutamate decarboxylase isoform 3 GAD3
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aje  Histoplasma capsulatum
Pathway
aje00250  Alanine, aspartate and glutamate metabolism
aje00410  beta-Alanine metabolism
aje00430  Taurine and hypotaurine metabolism
aje00650  Butanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
Module
aje_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HCAG_06585
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HCAG_06585
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HCAG_06585
   00430 Taurine and hypotaurine metabolism
    HCAG_06585
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HCAG_06585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 5445539
NCBI-ProteinID: XP_001538980
UniProt: A6R8E4
LinkDB All DBs
AA seq 590 aa AA seqDB search
MSSNDPTAATGNQCLERSEEVRNLLSAVQERIVAFIQSADQYDFSSAKIEHASARSSALV
QSMRPEELQAALNLEIPLSGQGQNGFLRILDQVLEYSVNTWHQGFLDKLYSSTNAPGIAA
ELIIASLNTNVHVYPVSPALTVIEKYTSKQVASLFGLDGPKAGGISVQGGSASNATSIVV
ARNTLFPKTKKDGCDGYKFVLFTSAHGHYSIEKAAQSLGFGSSAIWSVPVDQKGRMIPQS
LESLVVKAKNEGRTPFYVNATAGTTVLGSFDPLEQIAFICRKHNLWFHVDASWGGSYAFS
RRQRAKIAGSHLADSITVNPHKMLGVPVTCSFLLGADMNKFHRANTLPAAYLFHNDYLAA
DLNGNADVSVPEVWDLADMTLQCGRRADSLKFFLSWTYYGTEGYERQIDAASDMAAYFVA
AVSDCPNLLLISENPPPCLQVCFCYAPNKQLIFRRDQEIEGKRIDEEERGKRNSKITEEV
VQKLVHCGFMVDFAPPVEDDPSAGDGKFLRLLGHVSVLKEQNHSAWEILESVDMGQLFVI
ELEILGYLPHFYARKNVHVQSICIYRWTMDTEQAFANWLKLYNYATIFFS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaatgaccctacggccgccacagggaatcaatgtctggagaggagtgaggaa
gtacgaaatttattaagtgctgtccaagagcgcattgtagcctttatccagtctgcagac
caatatgatttcagctccgcaaagattgagcatgcctcggcccgcagttcggcactggta
cagagcatgagaccggaggaattacaagccgctttgaatcttgagatccccttatcaggt
cagggacaaaatggcttccttcgaattctagaccaggtgttagagtactcggtcaacaca
tggcaccagggatttctggacaaactgtattcatccacaaatgcgccgggtatcgcagcg
gagttgatcatcgcctcattgaatacaaatgttcatgtgtatccagtgtcacctgcactc
actgttattgaaaagtatacttcaaaacaggtagcatcgctttttggcttggatgggcct
aaagccggagggatatcggttcagggaggttcggcttctaacgctacctctatagtcgtc
gctcgaaatactctattccccaaaactaagaaggacggctgtgatggatacaagtttgtt
ctcttcactagtgcacatggccattattctattgaaaaggcagcacagtcgcttgggttc
ggaagcagtgctatttggtctgtgccagtcgaccagaaaggacgaatgatccctcaatct
ctggaaagtcttgttgtcaaagctaagaatgagggaaggacgccgttttacgtaaatgcg
accgctgggacaactgttctcgggtcatttgaccctttggaacaaattgctttcatttgc
cggaaacataatctttggtttcatgttgatgcttcttggggaggttcttatgcgttttcg
agaaggcaaagagcaaaaattgctggttcccacttggcggatagcatcaccgttaatccg
cacaaaatgctaggcgttccggtgacctgctcattcctcctgggtgcagatatgaacaaa
ttccaccgggcaaatacgctacctgcggcatatctgttccataacgattatttagctgct
gacctgaatggcaacgcagatgtgtctgtacccgaagtttgggatcttgctgatatgacg
ttgcaatgcggccgtcgagccgattccctcaagttttttttgagttggacttactacggc
acagaggggtatgagcgtcaaatagatgctgcttctgacatggccgcttattttgttgcg
gctgtttctgattgcccaaacctgctcctcatcagcgagaacccacccccttgcctccag
gtttgtttttgctatgctcctaacaaacaactcatcttccgccgcgatcaggaaattgag
ggtaagcgaattgacgaggaggaacgaggcaagcgaaatagcaagataactgaagaggtg
gtccaaaagctagtccattgtgggttcatggtcgacttcgcgccaccagttgaggacgat
ccatccgctggagatgggaagtttctcaggttgttgggccatgtgagcgttttgaaggag
caaaaccattccgcatgggaaatcctggagagcgtggacatgggccagttgttcgtcatt
gagcttgaaatccttgggtatcttcctcacttttacgcaaggaagaatgttcatgtgcag
tccatttgtatatatcgctggactatggatacagaacaggcatttgctaattggctgaaa
ttgtataattacgccaccatattcttctcgtga

DBGET integrated database retrieval system