KEGG   Histoplasma capsulatum: HCAG_07622Help
Entry
HCAG_07622        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
aje  Histoplasma capsulatum
Pathway
aje00061  Fatty acid biosynthesis
aje00062  Fatty acid elongation
aje01100  Metabolic pathways
aje01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HCAG_07622
   00062 Fatty acid elongation
    HCAG_07622
Enzymes [BR:aje01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     HCAG_07622
    1.3.1.-  
     HCAG_07622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N
Motif
Other DBs
NCBI-GeneID: 5443547
NCBI-ProteinID: XP_001537313
UniProt: A6RDB4
LinkDB All DBs
AA seq 438 aa AA seqDB search
MFSAGTAVRVLGRLKPINAVPSACASFRLSLDRRRYISAYGYTQAKALVYANYGEPKDVL
RLLNPSQHLSAFSLSIALCKPNPAANIFSNSLHSYSISPPHHTQVNVRLLTAPLNPADVN
QIQGVYPSKPAFSTTLGTSTPSTIAGNEAAFEVVSTGSGVKSLTKGDWVIMKRSGMGTWR
THAQFDEASLIKIEDRSNLTPLQVGTVGINPVTAYRMLKDFCEWDWVGKPGEEWVIQNGA
NSGVGRAVIQLGREWGIKTLNVIRERDSAAETAALTDDLLALGATAVVTEAQLLSSKTFR
DIVHERTRQGKEPIRLALNCVGGPSATAMLKVLAPESHMVTYGAMAKQPLTLPSGLLIFK
NLVLDGFWVSKWSDKNPVLKTETVNDILRLVRAGKFKDIPVQEKKWTWETEAAELAAEAQ
GTLSGRRSGKSVFVYEGD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgctgggacagctgtgcgcgtgctaggccgattgaagcctatcaacgccgtt
ccctccgcctgtgcctccttcagactctccctggaccgccgacggtatatctccgcctac
ggctacacccaggccaaagccttagtctacgccaactatggtgagcccaaagatgtctta
aggttgttaaacccctcccaacacctttccgcattctcgctgtcgatcgcactgtgtaag
ccaaatcccgctgctaacatcttctccaacagcctacattcctactctatctcccccccg
caccacacccaggtcaatgtccgcctcctcaccgcgcccctcaaccccgccgatgtcaac
caaatccagggcgtctatccttcaaaacccgccttctccacaaccctcggcacgtccacc
ccgtccaccatcgccggcaatgaagctgccttcgaggtcgtgtcaaccggctccggtgtc
aaatccctcacaaagggcgactgggtcatcatgaagcggtcggggatgggcacctggcgc
acgcacgcacaattcgacgaagcatccttgatcaagatcgaagaccgcagcaacctgacc
ccgctccaggtcggcaccgtcggcatcaaccccgtcaccgcctaccggatgctgaaggat
ttctgcgagtgggactgggtgggcaagccgggggaggaatgggtgattcagaacggagcg
aactccggcgtcggccgcgcggtcatccagctcgggcgcgaatggggcatcaagacgctg
aacgtcattcgcgagcgggactcggccgcggagacggcggcgctgacggacgacctgctg
gccctgggcgcgacggcggtcgtgacggaggcccagctcctctcgtccaagaccttccgc
gacatcgtgcacgaacggacgcgccagggcaaggagcccattcgcctggcgctgaattgc
gtgggcgggcccagcgcgacggcgatgttgaaggtgcttgcgcccgagtcgcatatggtc
acgtatggagcgatggcgaagcagcccctgacgctgccgtcggggttgttgattttcaag
aatctggtcctggatggtttttgggtgtcgaagtggagtgataagaatccagtgctgaag
acagagacagtcaatgatattttgaggttggtgagggcgggaaagttcaaggatataccc
gtccaagagaagaaatggacctgggagaccgaggcggcggagttggcggcagaggctcag
gggacgttgagcgggagaagaagcgggaagagtgtgtttgtgtacgaaggggattaa

DBGET integrated database retrieval system