KEGG   Histoplasma capsulatum: HCAG_08002Help
Entry
HCAG_08002        CDS       T02229                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
aje  Histoplasma capsulatum
Brite
KEGG Orthology (KO) [BR:aje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aje03036]
    HCAG_08002
Enzymes [BR:aje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     HCAG_08002
Chromosome and associated proteins [BR:aje03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     HCAG_08002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 5443248
NCBI-ProteinID: XP_001536893
UniProt: A6RED7
LinkDB All DBs
AA seq 693 aa AA seqDB search
MSHGLTHAAIIDFDLHHGDGSQDIAWEQNRKASAASRNSPSHKKTAIGYFSLHDINSYPC
EAGDVNKVRNASVCIDNAHGQSVWNIHLEPWKTSAGFWELYNTKYSILLEKARNFLRYHT
QRLINSQNPSLPKAAIFISAGFDASEWEGVGMQRHKVNVPTDFYAKFTADIVQIAEDEAL
GVDGRVISVLEGGYSDRALISGVLSHLSGLADSQRTGFENGDNRLATEMISRLGLNDCPE
TVLEEDSTFDTEWWTLPMLETLELLANPPPPTPARKSREKGPPTYCSPTQASAAKIVLPS
RDRRSISSQLSAGDSGYPRLPLPVVDWATAAYEMSKVLIPTNRQTVSLQHSELKGENTRT
KRDRHSTSNVSELNAADDRKPMQLRERKPKPPSPEHLTTKQPSKASRRATIASVSDIPDA
SATEPPESCNQNPKPVDSHSSRRLSVASTVASTGGARSRGSVEETSPPSSNGSSARRIDS
RRGTSNGKSGEPLTVKKLGGVRTSPRKPSAARQARPIGGGPIPPVRSSSINTDTSERDLT
NLSAVPSPEEHAAREEERRKIATSRSASRKSQTSKASRSSSTTATGKVSNPDTALAQSPP
PPPVAGTTLSTRFDPIKQEMAHLPHKNSDIEGIPIPDLSSFPHSANSYSEVVRGWPSDPT
TKRTHIEPSKNPSPATKKLSIVLARKLRRNEIH
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatggcctcacccatgctgctatcattgatttcgatttacaccacggagacggg
tcgcaggatattgcttgggagcaaaatcggaaggcaagtgcagcttccaggaattcccca
tctcataagaaaacggcaatcggttacttcagtctccacgacatcaactcgtatccttgt
gaggctggtgatgtaaacaaggttcgtaatgctagcgtttgcatcgataatgctcatggc
caatctgtctggaacatccatcttgaaccgtggaaaacttctgcgggcttttgggaactt
tacaatacgaagtactctatcctccttgaaaaagctcgaaactttctacgataccataca
cagcgtttgataaattctcaaaatccgtcgcttcccaaagcagctatttttatatctgct
gggtttgatgctagtgaatgggaaggcgttggtatgcaaagacacaaggtcaatgtaccg
acagatttctatgccaaattcacagcagatattgtgcaaatcgcagaagatgaagccctg
ggcgttgatggcagagttataagcgttttagaaggaggctactctgaccgagctctcata
agtggtgtgctcagccacctgtcagggcttgcggacagccagagaactggttttgaaaac
ggtgataaccgcctcgctactgaaatgataagtcgccttggtttgaatgactgccctgag
actgtcttagaagaggattcaacttttgatactgagtggtggacactccccatgctggaa
accctcgaactgcttgcaaacccaccgcctccaaccccggctcgcaaatctcgtgagaag
gggcctccgacatattgttctccaacccaggcatcagctgctaagatcgttctgccttcc
cgtgaccggagatcgatttcatcgcagcttagtgcaggggacagtggatatccgcgtctt
ccactcccagtcgttgactgggcaactgcagcatatgaaatgtcgaaagttcttattcct
accaatcgccagactgtgagtctccagcactcagaattaaaaggtgaaaatactcggaca
aagcgtgaccgccattcaacctcgaatgtttcagagttgaatgcggctgatgatcggaaa
ccaatgcaattgagggagagaaagccgaaaccaccatcgccagaacacctaactactaag
caaccttcaaaagcttcgcgaagggccaccatcgcctcggtgagcgacattcccgatgcc
tctgccaccgaacctcctgaaagttgtaaccaaaatcccaagcctgttgattcgcacagt
tcacgacgccttagtgtggcgtcgacggtggcatcaactggtggcgcccgtagcaggggc
agcgtagaggaaacttcaccaccctcctcaaatgggagtagcgcccgtaggatagattca
cgccgggggacctcgaatgggaagtctggggaaccactaacggtgaaaaaactcggaggt
gtccggaccagtccgagaaagccatcggcagctcgacaagcacgacctataggcggtggc
cccattccccctgttcgctcatcgtctataaacacagatacttcagagcgtgatctcacc
aatctctccgcagtcccaagcccggaagagcatgcggcgagagaagaggaacgcaggaag
attgctactagcagatccgcttccaggaaatcccagacctcgaaagcatctagatctagc
agcacaacggccaccgggaaggtctcaaaccctgacactgcgctagcccagtctccacct
ccgccgcctgttgctggcactaccctatccacccgcttcgaccctatcaagcaggaaatg
gcacacctccctcacaaaaactctgatattgagggaattcctatcccggacctatcgtct
ttcccacattcagccaactcatacagcgaggtggtacgggggtggccatccgacccaaca
accaagcgtacccacatcgagccatcaaaaaacccctcccctgccaccaaaaagctatct
attgttctagcaaggaaattgagaaggaacgagattcattga

DBGET integrated database retrieval system