KEGG   Histoplasma capsulatum: HCAG_08662Help
Entry
HCAG_08662        CDS       T02229                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aje  Histoplasma capsulatum
Pathway
aje00250  Alanine, aspartate and glutamate metabolism
aje00410  beta-Alanine metabolism
aje00430  Taurine and hypotaurine metabolism
aje00650  Butanoate metabolism
aje01100  Metabolic pathways
aje01110  Biosynthesis of secondary metabolites
Module
aje_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HCAG_08662
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HCAG_08662
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HCAG_08662
   00430 Taurine and hypotaurine metabolism
    HCAG_08662
Enzymes [BR:aje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HCAG_08662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 5442735
NCBI-ProteinID: XP_001536341
UniProt: A6RG96
LinkDB All DBs
AA seq 516 aa AA seqDB search
MVHLAAIRKESAVLPIRQIQRIETIPLEEPQEHDFYSSVYGSRFAAEDLPTLEMPEKEMP
KEVAYRMIRDELSLDGNPMLNLASFVTTYMEEEAEKLMTESFSKNFIDYEEYPQSAEIQN
RCVNMIARMFNAPGEDSPEHAMGTSCIGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNI
VMSSAVQVCWEKAARYFEVEEKFVYCTTERYVIDPEEAVNLVDENTIGICAILGTTYTGQ
YEDVQAINDLLVERGIDCPIHVDAASGGFVAPFVNPNLEWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRSPEYLPKELVFNINYLGADQASFTLNFSKGASQVIGQYYQMIRLGKRGYR
SIMINLTRTADYLGAALKELGFILMSDGRGHGLPLVAFRLSSKQGFEFDEFALAHQLRER
GWVVPAYTMAPHSEQLKLMRVVVREDFSRSRCDLLVADIKLALTHLSEMDRKAMDKYKLH
VRQHVSNVGKATHNPPIYKDDDHSLQGKTGKTHAIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggtccatctcgcagcaattcgaaaggaatcggcggtcctgccgattcgacaaatccag
cgtatcgaaactatcccgctcgaggagcctcaggaacatgatttttattccagcgtctat
ggctctcggttcgcggcagaggacttgcctacgttggagatgccagagaaagagatgccc
aaggaggtggcgtatagaatgatcagggacgaattgagtttggatgggaatccgatgttg
aacttggcaagcttcgttaccacctacatggaggaagaggcggagaagctcatgaccgaa
tcgttcagcaaaaacttcatcgattatgaggaatatccgcagtctgcagagatccagaac
cgctgtgtgaatatgatcgcccgcatgttcaatgctcctggcgaggattctccagaacat
gcgatgggaacatcatgtatcggttcttcggaggctataatgctgggcacacttgccatg
aaaaagcgctggcaaaacaagcgaaaagcagagggaaaggattactcacgccccaatatc
gtcatgagcagcgccgttcaggtctgctgggaaaaggcagctagatatttcgaagttgag
gagaaatttgtctattgcacgaccgaaagatacgtcatcgacccggaggaagctgtaaac
ctcgtggatgagaataccattggcatttgtgcaattttaggtactacttacaccggccag
tatgaggatgtacaagcaatcaacgatcttcttgtcgaacgtggcatcgattgccccatt
cacgttgatgctgccagcggtggatttgttgctccctttgtaaacccgaacttggaatgg
gatttcagacttgagaaagttgtctctattaatgtctccggacacaagtacggccttgtt
taccccggtgttggatgggtggtctggcgttctccggaatatctccctaaggagctcgtt
ttcaacatcaactacctcggcgccgatcaagctagcttcacccttaatttctccaaaggt
gcttcgcaagtcattggtcaatattatcaaatgatccgcttgggaaaacgaggctaccgc
tccataatgatcaaccttacacgcaccgctgattatcttggagctgccctgaaggaactg
gggttcattctcatgagcgatggtcgcgggcatggcttgccccttgttgccttccgcctt
tcatccaagcagggctttgagttcgatgagtttgcgcttgcacatcagcttcgggaacgt
ggctgggtggtacctgcgtacactatggcgccacatagcgagcagttgaaactcatgcgt
gttgttgttcgagaggatttcagtagaagccgctgcgacctgttagtcgcggatattaag
cttgcgttgacacacctgagcgagatggatcggaaggccatggacaaatataagctccat
gtacgccaacacgtttccaatgtcggcaaagccacccataaccccccgatttacaaggat
gatgatcactcgctgcaaggaaagaccgggaaaactcacgccatctgttaa

DBGET integrated database retrieval system