KEGG   Acidipropionibacterium jensenii: C0Z10_01780Help
Entry
C0Z10_01780       CDS       T05836                                 

Definition
(GenBank) zinc-binding dehydrogenase
Organism
aji  Acidipropionibacterium jensenii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NCD3G TrkA_N 2-Hacid_dh_C ADH_N_2
Motif
Other DBs
NCBI-ProteinID: AZZ38685
UniProt: A0A3Q9UCE7
LinkDB All DBs
Position
402445..403488
Genome map
AA seq 347 aa AA seqDB search
MTETMLAERFYAKDHSIHLEDVPVPHPGPGNVLIEVAYCGICHSDLSLINGTFPAQLPEV
TQGHEASGTIVEVGVGVTGWKVGDRVIPSAGRPCFTCRKCRRGDFANCLHLNLMAFAYDG
AWAKYHEAAATGLTKIPENVPMDQAALLADAVSTPYAAVVHTAQVHMGNAVAVWGVGGVG
THLVQLAKVAGGVPVIAIDLNDEVLARAKRVGADHVLHSDDPDLMSKIEDLTHGRMIDVA
FDAVGIKPTLRAAVDSLDVDGKAVSLGLSSQDIDAGPFMNFNLQRKRVYGHLGYRGQDIG
VLAEMLSYHRLDLSESISEVIPLSEIKRGIQDLEEHRNNPIRILVKP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaccatgctggccgagaggttctacgccaaggaccacagcatccatctggag
gacgtccccgttccccacccggggccgggcaatgtcctcatcgaggtggcctactgcggg
atctgccactcggatctgagcctcatcaacggcaccttccccgcccagcttcccgaggtc
acccagggccatgaggcctccgggaccatcgtggaggtcggcgtcggggtcaccggctgg
aaggtgggggaccgcgtcatcccgtcggccgggcgtccctgcttcacctgccgcaagtgc
cgtcgcggagacttcgccaactgcctccacctcaatctgatggccttcgcctacgacggg
gcgtgggcgaagtaccacgaggcggccgccaccgggctgacgaagatccccgagaacgtg
ccgatggaccaggctgccctgctggccgacgccgtctccaccccctacgcggcggtggtg
cacaccgcccaggtgcacatgggcaatgcggtggcggtctggggggtcgggggagtcggc
acccacctcgttcagctggcgaaggtcgccggcggtgtcccggtgatcgccatcgatctc
aacgacgaggtgctggcccgtgccaagcgggtcggcgccgaccacgtgctgcacagcgac
gatcccgatctgatgagcaagatcgaggacctcacccacggccggatgatcgacgtcgcc
ttcgacgcggtgggcatcaagccgaccctgcgcgccgccgtcgactccctggacgtcgac
ggcaaggcggtctccctgggcctgtccagccaggacatcgacgccggtccgttcatgaac
ttcaaccttcagcgcaagagggtctacggccacctgggataccggggccaggacatcggg
gtgctggcggagatgctgtcctaccatcgcctggacctctcggagtcgatctccgaggtg
atcccgctgagcgagatcaagcgcggcatccaggatctggaggagcaccggaacaacccg
atccggatcctcgtcaagccctga

DBGET integrated database retrieval system