KEGG   Acidipropionibacterium jensenii: C0Z10_02230Help
Entry
C0Z10_02230       CDS       T05836                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
aji  Acidipropionibacterium jensenii
Brite
KEGG Orthology (KO) [BR:aji00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aji02000]
    C0Z10_02230
Transporters [BR:aji02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    C0Z10_02230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_22 AAA_15 AAA_29 AAA_30 NACHT AAA_23 AAA_27 AAA_5 Rad17 Adeno_IVa2 Mg_chelatase RsgA_GTPase AAA_33 AAA_25 AAA_28 AAA_14 KH_1 Viral_helicase1 ATPase_2 RNA_helicase AAA_24
Motif
Other DBs
NCBI-ProteinID: AZZ38759
UniProt: A0A3T0RXV5
LinkDB All DBs
Position
complement(504254..505156)
Genome map
AA seq 300 aa AA seqDB search
MTDHDFSAEAVTVGYGERTVIEALDLTVPDHRMGAIIGPNGCGKSTLLRTMARLLRPSSG
AVLLDGRMIHQMPTRAVATVLGLLPQSPTCPDGIVVEDLVSRGRAPHRGTFARWTAADDE
AIASAMALTGTAELATRPVDELSGGQRQRVWIAMALAQQTDLLLLDEPTTYLDLAYQIDV
LELLAELNRSTGTTVVMVLHDINLAARYCDWLVAMREGTVMARGRPADVVTQDTMTRVFD
LNTRVIADPVNGSPIVIPLGRARPAPQQPEQPEQPEKPGQPGQPAPEDRPSQQTGNRGAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcacgacttctccgccgaggcggtcaccgtcgggtacggcgagcgcaccgtc
atcgaggccctcgacctgaccgtccccgaccaccggatgggcgccatcatcggacccaac
ggatgcggcaagtccaccctgctgcgcaccatggcccggctgctgagaccctcctccggg
gccgtcctgctggacggccggatgatccaccagatgcccacccgggccgtcgccacggtg
ctcggtctgctgccccagtcgcccacctgccccgacgggatcgtggtcgaggacctggtc
tcccgcggccgggccccgcaccgcggcaccttcgcgcgctggacggccgccgatgacgag
gcgatcgcctcggcgatggcgcttaccggcaccgccgagctggccacccgtccggtcgac
gagctgtcggggggccagcgccagcgggtctggatcgcgatggcgctggcccagcagacc
gacctgctgctgctggacgagccgaccacctatctggatctggcctaccagatcgacgtg
ctggaactgctcgccgagctcaaccgcagcaccggcacgacggtggtcatggtgctccac
gacatcaacctcgccgcccgctactgcgactggctggtggcgatgcgggaggggacggtg
atggcccggggacgtcccgccgatgtggtcacccaggacaccatgacccgggtcttcgac
ctgaacacccgggtgatcgccgacccggtcaacggctcgccgatcgtgatcccgctcggc
agggcgcgtccggccccgcagcaacccgaacagccggaacagccagagaagccgggacag
ccgggacagccggccccggaggaccggccctcgcagcagaccgggaaccggggcgcggca
tga

DBGET integrated database retrieval system