KEGG   Acidipropionibacterium jensenii: C0Z10_02435Help
Entry
C0Z10_02435       CDS       T05836                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aji  Acidipropionibacterium jensenii
Brite
KEGG Orthology (KO) [BR:aji00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C0Z10_02435
Enzymes [BR:aji01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C0Z10_02435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thi4 Thioredoxin_3 FAD_oxidored DAO Glutaredoxin FAD_binding_3 HI0933_like AlaDh_PNT_C NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AZZ38789
UniProt: A0A3T0RXY2
LinkDB All DBs
Position
complement(547418..548998)
Genome map
AA seq 526 aa AA seqDB search
MLDPALTQQLKTYLAMTTEPVVLVPSPGTDKRSEQMMELLGEIEAAGERVTVADPIADDR
TPSFAITRPGTDISVRFAGLPMGHEFNSLVLALLQVGGVPVKADAALLDAVRGLSGHHEF
TTYMSLTCQNCPTVVQALNAMSITNPNIRHTAVEGGAFAAEVKAKGIQSVPAIYLDGQEW
GSGRMTMADILAKLDSAAAEQAAEDLSQREPYDVLVVGAGPAGASAAVYAARKGIRTAMA
GERIGGQVLDTDAIENLISVPHTTGPKLAASLSAHISDYQIDAIERQHATELIPAGEDGL
TGVRFSDGVLRAKAVVLATGARWRQLGVPGEQEYKTKGVTYCPHCDGPLFKGQDVAVVGG
GNSGIEAAIDLAGVTGHVTVLEFMDSLKADAVLLSTLESLPNVDVITSAQSTQVVGDGSH
VTGLEYRDRGTGELHTVPVRGIFVQIGLLPNTEWLEGAVNLTKRGEIVVNTRGATSVPGV
FAAGDCTTQPFKQIIISMGSGATAALGAFDHIIRSAGAAKTLAKAS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcccgccctcacccaacagctcaagacctacctggcgatgaccaccgaaccg
gtcgtcctggtgccctcccccggcaccgacaagaggtccgagcagatgatggagctcctc
ggtgagatcgaggccgccggcgagcgggtcaccgtcgccgacccaatcgccgacgaccgc
accccctccttcgccatcacccgccccggcaccgacatctcggtgcgcttcgcgggcctg
ccgatgggccacgagttcaactccctggtattggccctgctccaggtcggaggggttccg
gtcaaggccgacgccgccctgctggacgccgtccgcggcctgtccggccaccacgagttc
accacctacatgtcgctgacctgccagaactgcccgacggtggtccaggccctcaacgcg
atgagcatcaccaacccgaacatccggcacaccgcggtggagggcggggccttcgccgcc
gaggtcaaggccaagggcatccagtcggtgccggccatctatctggacggtcaggagtgg
ggttcgggccggatgacgatggccgacatcctggccaagctggactccgcggctgccgag
caggccgccgaggacctctcgcagcgcgagccctacgacgtcctggtggtgggtgccggc
ccggccggagcctccgccgccgtctacgccgcccgcaaggggatccgcaccgcgatggcc
ggtgagcggatcggcggacaggtgctcgacaccgacgccatcgagaacctcatctcggtg
ccgcacaccaccggcccgaagctggccgcctcgctcagcgcccacatcagcgactaccag
atcgacgccatcgagcgtcagcacgccaccgagctcatcccggccggggaggacggcctg
accggcgtccggttctccgacggggtgctgcgcgccaaggccgtggtgctggccaccggc
gcccgctggcgtcagctgggggtgcccggcgagcaggagtacaagaccaagggtgtcacc
tactgcccgcactgcgacggcccgctgttcaagggtcaggacgtcgcggtggtcggcggc
ggcaactccggtatcgaggcggccatcgacctggccggtgtcaccggtcatgtcaccgtc
ctcgagttcatggactccctcaaggccgacgccgtgctgctgtcgaccctggagtcgctg
cccaatgtcgacgtcatcacctcggcccagtcgacccaggtggtcggcgacggctcgcac
gtcaccggtctggagtaccgcgaccgcggcaccggcgagctgcacaccgtgccggtgcgc
ggaatcttcgtccagatcggactgctgcccaacaccgagtggctcgagggtgcggtcaac
ctcaccaagcgcggcgagatcgtcgtcaacacccgcggcgccacctcggtgcccggtgtc
ttcgccgccggtgactgcaccacccagcccttcaagcagatcatcatctcgatgggatcg
ggtgccaccgcggcactgggcgccttcgatcacatcatccgctccgccggagccgccaag
accttggccaaggcgtcctga

DBGET integrated database retrieval system