KEGG   Acidipropionibacterium jensenii: C0Z10_04555Help
Entry
C0Z10_04555       CDS       T05836                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aji  Acidipropionibacterium jensenii
Pathway
aji00061  Fatty acid biosynthesis
aji00780  Biotin metabolism
aji01100  Metabolic pathways
aji01130  Biosynthesis of antibiotics
aji01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aji00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C0Z10_04555
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C0Z10_04555
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C0Z10_04555
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aji01004]
    C0Z10_04555
Enzymes [BR:aji01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C0Z10_04555
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C0Z10_04555
Lipid biosynthesis proteins [BR:aji01004]
 Fatty acid synthase
  Component type
   C0Z10_04555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AZZ39138
UniProt: A0A3T0S7Z0
LinkDB All DBs
Position
1008022..1008795
Genome map
AA seq 257 aa AA seqDB search
MGLLEGKTILVTGVTMHTSIAFKVAQIAQDEGARVIVSNIPRAIRVTHRAVRKLDPVPEV
IELDATDEEQLTALPETLRALGVEKLDGVVHAIAFANPKTALGGEFLNTEWHDVDVALHT
STYSYVSLAKAVQPLFGTTAAVVGLTFDATVSWPFYDWMGVAKAGLESANRYLARYLGKD
GVRCNLVSAGPLDTMAKTSIPGADAFNDLWGDRAPLGWDTKDATAAAKAVVALLSDWFPA
TTGEMVHADGGLHSTGA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggacttctcgaaggaaagaccatcctggtcactggggtgacgatgcacacctcgatc
gccttcaaggtggcgcagatcgcacaggacgagggcgcccgggtcatcgtctccaacatc
ccccgcgcgatccgggtcacccaccgggcggtccgcaagctggatccggtacctgaggtg
atcgagctggacgccaccgacgaggagcagctcaccgccctcccggagaccctgcgcgca
ctgggggtcgagaagctcgacggcgtcgtccacgcgatcgccttcgccaacccgaagacc
gccctgggcggggagttcctcaacaccgagtggcacgacgtcgacgtcgccctgcacacc
tcgacctactcctacgtctccctggccaaggccgtccagccgctgttcggcacgaccgcc
gcggtggtcgggctcaccttcgacgcgaccgtgtcatggcccttctacgactggatggga
gtggccaaggccggtctggagtcggccaaccgctacctggcccgctacctgggcaaggac
ggggtgcgctgcaacctcgtctcggccggaccgctggacaccatggccaagacctccatc
cccggggccgacgccttcaacgacctgtggggggaccgagccccgctgggatgggacacc
aaggacgccacggcggccgccaaggccgtggtggccctgctgtccgactggttcccggcc
accaccggtgagatggtgcacgccgacggaggactgcactccaccggcgcctga

DBGET integrated database retrieval system