KEGG   Acidipropionibacterium jensenii: C0Z10_04920Help
Entry
C0Z10_04920       CDS       T05836                                 

Gene name
sdhA
Definition
(GenBank) FAD-binding protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aji  Acidipropionibacterium jensenii
Pathway
aji00020  Citrate cycle (TCA cycle)
aji00190  Oxidative phosphorylation
aji00650  Butanoate metabolism
aji01100  Metabolic pathways
aji01110  Biosynthesis of secondary metabolites
aji01120  Microbial metabolism in diverse environments
aji01130  Biosynthesis of antibiotics
aji01200  Carbon metabolism
Module
aji_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aji_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aji00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0Z10_04920 (sdhA)
   00650 Butanoate metabolism
    C0Z10_04920 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C0Z10_04920 (sdhA)
Enzymes [BR:aji01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C0Z10_04920 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     C0Z10_04920 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like GIDA NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AZZ39202
UniProt: A0A3Q9UQ45
LinkDB All DBs
Position
1083257..1085281
Genome map
AA seq 674 aa AA seqDB search
MSTSAKETNAELAGQYWQVGEDIQDKKANVSLPIEKMWPDRQFTSRLVNPANRRKMTVII
VGTGLAGGAAAATLGEAGYRVENFCYQDSPRRAHSIAAQGGINAAKNYKYDGDSVYRLFY
DTVKGGDYRARETNVYRLAAVSANIIDQCVAQGVPFAREYGGLLDNRSFGGVQVQRTFYA
RGQTGQQLLIGAYQALERQVNAGTVHMHTRHEMVELIVADGRARGIVTRDMITGKIEEWL
ADVVVLATGGYGNVFFLSTNAMGCNVTATWRAHRKGAFFGNPCFTQIHPTCIPVHGDNQS
KLTLMSESLRNDGRIWVPKKAEDCEKDPRQIPEADRDYYLERIYPSFGNLVPRDIASRQA
KYRCDEGLGVGPKVKEIDHDGTEHMRSRGVYLDFAEAIGRLGKDAVEKKYGNLFDMYQRI
TDENPYEVPMRIYPAVHYTMGGLWVDYDLESSIPGLFVCGEANFSDHGANRLGASALMQG
LADGYFVLPNTITDYLADSPKFPKVDLKHPAVVAARQGVESRVNKLLSINGTRTVDSIHK
ELGHIMWEYCGMERNEAGLVKAIGLIRNLRNEFWTNVKVTGVNEELNQTLERAGRLADFL
ELGELMCIDALHRRESCGGHFRAESQTEEGEALRHDDTYQYVAAWEWTGEGHKPVLHKEP
LIYNSIQVKQRSYK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgtccacttcagccaaagagaccaatgccgaactggcaggccagtactggcaggtcggt
gaagacattcaggacaagaaggccaatgtcagccttccgatcgagaagatgtggcccgac
cgtcagttcacctcgcgtctggtgaacccggccaaccgccgcaagatgaccgtcatcatc
gtcgggacggggctcgccggcggcgctgcggcagccaccctcggtgaggccggctaccgc
gtggagaacttctgctaccaggactccccgcgtcgcgcccactcgatcgcagcacagggc
ggcatcaacgccgccaagaactacaagtacgacggcgactccgtctaccggctgttctac
gacaccgtcaagggcggcgactaccgcgcccgtgagaccaacgtctaccgcctcgccgcg
gtgagcgcgaacatcatcgaccagtgcgtcgcccagggtgttccgttcgcccgcgagtac
ggcggactgctcgacaaccggtccttcggcggcgtgcaggtgcagcgcaccttctacgcc
cgtgggcaaacgggtcagcagctgctgatcggcgcctaccaggctctcgagcgtcaggtc
aacgccggcaccgtgcacatgcacacccgccacgagatggtcgagctgatcgtcgccgac
ggccgcgcacgcggcatcgtcacccgcgacatgatcaccggcaagatcgaggagtggctg
gcggacgtcgtcgttctggccaccggtggatacggcaacgtgttcttcctgtcgaccaac
gccatgggctgcaatgtcaccgccacctggcgggcgcaccgcaagggcgccttcttcggc
aacccctgcttcacgcagatccacccgacctgcatcccggtgcacggcgacaaccagtcc
aagctcaccctgatgtcggagtcgctgcgaaacgacggtcgcatctgggtgcccaagaag
gccgaggactgcgagaaggacccccgccagatccccgaggcggaccgcgactactacctg
gagcggatctacccctccttcggcaacctggttccccgtgacatcgcgtcccggcaggcc
aagtaccgctgcgacgagggtctcggtgtcggaccgaaggtcaaggagatcgatcacgac
ggcacggagcacatgcgctcccgcggcgtctacctcgacttcgccgaggccatcggccga
ctgggcaaggacgccgtcgagaagaagtacggcaacctgttcgacatgtaccagcggatc
accgatgagaacccctacgaggttccgatgcggatctaccccgcggtgcactacacgatg
ggcggactgtgggtcgactacgacctggagtcgtccatccccgggctgttcgtgtgcgga
gaggccaacttctccgaccacggtgcgaaccggctgggcgcttcggccctgatgcagggt
ctggccgacggctacttcgtgctgccgaacaccatcaccgactacctggcggactccccg
aagttccccaaggtggatctgaagcacccggccgtggtggccgcccgtcagggcgtcgag
agccgtgtcaacaagctgctgtcgatcaacggcacccgcacggtggactcgatccacaag
gaactcggccacatcatgtgggagtactgcggcatggagcgcaatgaggccggcctggtc
aaggccatcggtctcatccgcaacctgcgcaacgagttctggaccaacgtcaaggtcacc
ggcgtcaacgaggagctcaaccagaccctcgagcgcgccggtcgtctcgccgacttcctg
gagctcggtgagctgatgtgcatcgacgccctgcaccgtcgcgagtcctgtggcgggcac
ttccgtgccgagtcccagaccgaggagggcgaggcgctgcgtcacgacgacacctaccag
tacgtcgccgcctgggagtggaccggtgagggtcacaagcccgtcctgcacaaggaaccg
ctgatctacaactcgatccaggtcaagcagaggagctacaagtga

DBGET integrated database retrieval system