KEGG   Acinetobacter junii: BVL33_01595Help
Entry
BVL33_01595       CDS       T04674                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ajn  Acinetobacter junii
Pathway
ajn00620  Pyruvate metabolism
ajn00680  Methane metabolism
ajn01100  Metabolic pathways
ajn01120  Microbial metabolism in diverse environments
ajn01200  Carbon metabolism
Module
ajn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ajn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BVL33_01595
  09102 Energy metabolism
   00680 Methane metabolism
    BVL33_01595
Enzymes [BR:ajn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BVL33_01595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APU47316
LinkDB All DBs
Position
complement(330859..333540)
Genome map
AA seq 893 aa AA seqDB search
MIQQITAPLREDVRLLGNLLGETLKLHAGQDLFNQIEQIRALAKGARDGQIEAEKQLEQL
FLGLKDEEILPLTRAFSHFLNFANIAEQYHVVRSRRHAEFDEHASSPNPLTHLFEKFKNQ
QISEQQLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDITDCLSQLDQKKLTPRERQQTI
ATLKQLVTSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAVPKFIRELNELTQQHCLQA
LPLSIAPIRFASWMGGDRDGNPNVTHQVTQEVLWLSRWQAADLYLRDIENLRWELSIQNC
SKELSEALGYEHPEPYREYLRITRERLKATRYCLGQRLQGLDADDSNIIRNKDELLAPLL
LCYRSLVDSNLAEIANGQLLDFIYRVNCFGIELLKLDIRQESGRHRQAISAITEYLGLGN
FESWTEQARQNFLIQELQSKRPLLPKYLNEPEGSLIQHPDVLEVFATMRTLAEQPAESLG
AYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFETLKDLDGAAKTMDTLFNMHWYKQH
IHGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTAVAKKHDVQLTLFHGRGGSISRGGA
PTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEGIALQNLEIYTAATLEATLLPPPEPK
KEWRDLMNQMTDLSVKVYRQTVRENPNFVSYLRTVTPELELQMLPLGSRPAKRKVSGGIE
SLRAIPWVFAWTQIRLMLPAWLGTGTAINQVHEQHKNTLNDMLDQWPYFQTLIDMLEMVL
SKSDADIALYYESHLTDDQDLKALGIELRQRLQNAVDTLLNLKGESKLLSNNEVLDQSMQ
VRKPYLLPLHLLQAELMKRRRLYLAEHQTEHTPVDHALMVSIAGIAAGLRNTG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacaaatcacagctccattgcgggaagacgtccgattactgggcaacttactt
ggcgaaacattaaaactacatgctgggcaagatttgtttaatcaaattgagcaaattcgc
gctttagctaaaggcgcacgtgatggtcaaatagaagcagagaagcagttagaacagctt
ttccttgggctaaaagatgaggagattttgcccttaacacgagcattctcacattttctt
aacttcgctaatatcgctgaacaatatcacgtggtacgtagtcgacgtcatgcagagttt
gacgagcatgcgtctagcccaaatccactcactcacctttttgagaaatttaaaaatcag
caaatttctgaacagcaattatttcaacaaatttgcgatctaaaaattgaactagtactc
acagcgcatccaacagaagtgagtcgtcgtaccctgatccaaaaatatgatgatattacg
gattgtctatcacagcttgatcaaaagaaattaacgcctcgtgaacgtcaacagaccatc
gccacactcaaacagctagtcacctctgcatggcaaaccgatgaaatccgtcaacaccgc
ccgacgcctgtagatgaagcaaaatgggggtttgcaacgattgaacaaacgttatggaat
gctgtacctaaatttattcgtgaattaaatgaattaacacaacagcattgcctgcaagct
ttgcctctcagcatagcaccgatccgttttgcctcatggatgggtggcgaccgcgatggt
aatccgaatgtcactcatcaagtgacacaggaagtcctgtggttatcgcgttggcaggct
gcagatttatacctccgtgatattgaaaatctacgttgggaactttctatccaaaattgt
tctaaagaacttagtgaagctttaggttatgaacatcctgagccgtaccgtgaatatctt
cgcattacccgtgaacgacttaaagcaacacgttattgtttaggtcaacgtttacaaggt
ttggatgccgacgatagcaatatcattcggaataaagatgaattattggcccctcttctg
ctttgctatcgttcccttgttgacagtaaccttgcggaaatcgccaatggacaattgctt
gattttatctatcgtgtgaattgttttgggattgaactactcaaacttgatatccgccaa
gaatcaggtcgtcatcgtcaagccatttctgcgattacggaatatttaggtttgggtaat
ttcgaatcgtggacagaacaagcgcgtcaaaacttcttgattcaggaattacaaagtaaa
cgtccattattacctaagtatttgaatgagccagaaggtagtctcattcaacatccagat
gtgctcgaagtgtttgccactatgcgtaccctagctgagcaaccagcagagagtttaggg
gcttatatcatttcaatggctgaatatccaagtgatgtgttggctgtattgctcttgcaa
aaagaagcgggcattcaacatcctctgcgtgtcgtgccattgttcgaaaccttgaaagat
ttggacggcgctgccaaaaccatggataccttgtttaatatgcattggtacaagcagcat
atccatggcaaacatgaagtgatgattggttattctgactctgccaaagatgcaggcttt
atgtcagcaaattgggctcaatatcgtgcacaagaagaactcaccgcggttgcaaaaaaa
catgatgtgcaattaaccctattccatggtcgtggtggttcaatcagtcgtggcggtgct
ccaacccaacaagcactcttttctcaaccaccaggctcaatctcaggtgctattcgtgtg
actgagcaaggtgaaatgatccgctttaaatttggtttagaagggattgccttacaaaac
ttggaaatctatactgctgcgaccttagaagcgactttattaccaccgccagaacctaag
aaagaatggcgtgatttgatgaatcagatgacggatctctccgttaaggtatatcgccaa
acggttcgtgagaatccaaattttgtgagttatttgcgtaccgttacaccagaattagag
ctgcaaatgttgccattgggatcacgcccagcaaaacgaaaagtaagtggcggcatcgaa
tccttacgtgcaattccatgggtatttgcttggacacaaattcgtttgatgttgcccgct
tggctgggaactggcaccgcaattaatcaagtgcatgaacaacataaaaatacgctcaat
gacatgctagatcagtggccgtatttccaaaccttaattgatatgttggaaatggtattg
tctaaatcagatgcagacattgcgttgtattacgaatctcatttgaccgatgatcaggac
ctcaaagctctcgggatagagttaagacaacgattacaaaatgcggttgatacacttttg
aatctgaaaggtgagtctaaactcctgagcaataatgaggtcttagatcagtcgatgcag
gttagaaaaccctatctattgccacttcatttgttgcaagctgagttgatgaaacgtcgt
cgtttatatttagctgagcatcaaacagaacatacacctgttgatcatgccttaatggtg
agtattgctggtattgccgcagggcttcgcaatacaggttaa

DBGET integrated database retrieval system